AMPDB_3857 | Circulin-A

PEPTIDE SUMMARY

Circulin-A

1 General Description

AMPDB ID: AMPDB_3857

Protein Names: Circulin-A (CIRA)

Protein Family: Cyclotide family; Bracelet subfamily

Gene Name: Nil

Source Organism: Chassalia parviflora

Protein Length: 30 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

GIPCGESCVWIPCISAALGCSCKNKVCYRN

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 2, 'R': 1, 'N': 2, 'D': 0, 'C': 6, 'Q': 0, 'E': 1, 'G': 3, 'H': 0, 'I': 3, 'L': 1, 'K': 2, 'M': 0, 'F': 0, 'P': 2, 'S': 3, 'T': 0, 'W': 1, 'Y': 1, 'V': 2

Frequencies of Amino Acids

'A': 6.67%, 'R': 3.33%, 'N': 6.67%, 'D': 0%, 'C': 20%, 'Q': 0%, 'E': 3.33%, 'G': 10%, 'H': 0%, 'I': 10%, 'L': 3.33%, 'K': 6.67%, 'M': 0%, 'F': 0%, 'P': 6.67%, 'S': 10%, 'T': 0%, 'W': 3.33%, 'Y': 3.33%, 'V': 6.67%

Missing Amino Acid(s)

D, F, H, M, Q, T

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

E, L, R, W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	3175.78 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	78	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	26.557	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.417	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.258	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.111	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	1.626	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.267, 0.333, 0.133 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.067	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	6990, 7365	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Plant defense, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Fujikawa K, Suketa Y, Hayashi K, et al. Chemical structure of circulin A. Experientia. 1965;21(6):307-8. Published 1965 Jun 15. doi:10.1007/BF02144681

PMID: 4288271

Citation 2: Derua R, Gustafson KR, Pannell LK, et al. Analysis of the disulfide linkage pattern in circulin A and B, HIV-inhibitory macrocyclic peptides. Biochem Biophys Res Commun. 1996;228(2):632-8. Published 1996 Nov 12. doi:10.1006/bbrc.1996.1708

PMID: 8920961

Citation 3: Tam JP, Lu YA, Yang JL, et al. An unusual structural motif of antimicrobial peptides containing end-to-end macrocycle and cystine-knot disulfides. Proc Natl Acad Sci U S A. 1999;96(16):8913-8. Published 1999 Aug 3. doi:10.1073/pnas.96.16.8913

PMID: 10430870

Citation 4: Daly NL, Koltay A, Gustafson KR, et al. Solution structure by NMR of circulin A: a macrocyclic knotted peptide having anti-HIV activity. J Mol Biol. 1999;285(1):333-45. Published 1999 Jan 8. doi:10.1006/jmbi.1998.2276

PMID: 9878410

5.2 Protein Sequence Databases

UniProt: P56871

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P56871

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR005535, IPR012323, IPR036146

PANTHER: Not found

PROSITE: PS51052, PS60008

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download