AMPDB_3854 | Frenatin-3

1 General Description

AMPDB ID: AMPDB_3854

Protein Names: Frenatin-3

Protein Family: Frog skin active peptide (FSAP) family; Frenatin subfamily

Gene Name: Nil

Source Organism: Nyctimystes infrafrenatus (White-lipped tree frog) (Litoria infrafrenata)

Protein Length: 68 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MHFLKKSIFLVLFLGLVSLSICEKEKREDQNEEEVDENEEESEEKRGLMSVLGHAVGNVLGGLFKPKS

FASTA format

Counts of Amino Acids

'A': 1, 'R': 2, 'N': 3, 'D': 2, 'C': 1, 'Q': 1, 'E': 12, 'G': 6, 'H': 2, 'I': 2, 'L': 10, 'K': 7, 'M': 2, 'F': 4, 'P': 1, 'S': 6, 'T': 0, 'W': 0, 'Y': 0, 'V': 6

Frequencies of Amino Acids

'A': 1.47%, 'R': 2.94%, 'N': 4.41%, 'D': 2.94%, 'C': 1.47%, 'Q': 1.47%, 'E': 17.65%, 'G': 8.82%, 'H': 2.94%, 'I': 2.94%, 'L': 14.71%, 'K': 10.29%, 'M': 2.94%, 'F': 5.88%, 'P': 1.47%, 'S': 8.82%, 'T': 0%, 'W': 0%, 'Y': 0%, 'V': 8.82%

Missing Amino Acid(s)

T, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

A, C, P, Q

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7691.81 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	95.882	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	56.56	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.338	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.491	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.649	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-4.862	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.324, 0.235, 0.368 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.059	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 0	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Bacillus cereus (Gram-positive), Escherichia coli (Gram-negative), Leuconostoc mesenteroides (Gram-positive), Micrococcus luteus (Gram-positive), Staphylococcus aureus (Gram-positive), Streptococcus uberis (Gram-positive)

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Zhou M, Chen T, Walker B, et al. Novel frenatins from the skin of the Australasian giant white-lipped tree frog, Litoria infrafrenata: cloning of precursor cDNAs and identification in defensive skin secretion. Peptides. 2005;26(12):2445-51. Published 2005 Dec. doi:10.1016/j.peptides.2005.05.019

PMID: 15996792

Citation 2: Raftery MJ, Waugh RJ, Bowie JH, et al. The structures of the frenatin peptides from the skin secretion of the giant tree frog Litoria infrafrenata. J Pept Sci. 1996;2(2):117-24. Published 1996 Mar-Apr. doi:10.1002/psc.60

PMID: 9225251

Citation 3: Doyle J, Llewellyn LE, Brinkworth CS, et al. Amphibian peptides that inhibit neuronal nitric oxide synthase. Isolation of lesuerin from the skin secretion of the Australian Stony Creek frog Litoria lesueuri. Eur J Biochem. 2002;269(1):100-9. Published 2002 Jan. doi:10.1046/j.0014-2956.2002.02630.x

PMID: 11784303

Citation 4: Brinkworth CS, Carver JA, Wegener KL, et al. The solution structure of frenatin 3, a neuronal nitric oxide synthase inhibitor from the giant tree frog, Litoria infrafrenata. Biopolymers. 2003;70(3):424-34. Published 2003 Oct. doi:10.1002/bip.10524

PMID: 14579314

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: P56249

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AJ937524	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR004275, IPR016322

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download