AMPDB_3844 | Cathelicidin-5

PEPTIDE SUMMARY

Cathelicidin-5

1 General Description

AMPDB ID: AMPDB_3844

Protein Names: Cathelicidin-5 (Antibacterial peptide BMAP-28) (Myeloid antibacterial peptide 28)

Protein Family: Cathelicidin family

Gene Name: CATHL5 BMAP28

Source Organism: Bos taurus (Bovine)

Protein Length: 159 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

METQRASLSLGRWSLWLLLLGLALPSASAQALSYREAVLRAVDQLNEKSSEANLYRLLELDPPPKEDDENPNIPKPVSFRVKETVCPRTSQQSPEQCDFKENGLLKECVGTVTLDQVGSNFDITCAVPQSVGGLRSLGRKILRAWKKYGPIIVPIIRIG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 10, 'R': 11, 'N': 6, 'D': 7, 'C': 4, 'Q': 8, 'E': 11, 'G': 10, 'H': 0, 'I': 8, 'L': 22, 'K': 9, 'M': 1, 'F': 3, 'P': 12, 'S': 14, 'T': 6, 'W': 3, 'Y': 3, 'V': 11

Frequencies of Amino Acids

'A': 6.29%, 'R': 6.92%, 'N': 3.77%, 'D': 4.4%, 'C': 2.52%, 'Q': 5.03%, 'E': 6.92%, 'G': 6.29%, 'H': 0%, 'I': 5.03%, 'L': 13.84%, 'K': 5.66%, 'M': 0.63%, 'F': 1.89%, 'P': 7.55%, 'S': 8.81%, 'T': 3.77%, 'W': 1.89%, 'Y': 1.89%, 'V': 6.92%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	17616.3 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	99.937	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	44.681	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.237	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.947	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.315	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	1.767	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.314, 0.264, 0.277 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.057	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	20970, 21220	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Staphylococcus aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-MRSA, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Skerlavaj B, Gennaro R, Bagella L, et al. Biological characterization of two novel cathelicidin-derived peptides and identification of structural requirements for their antimicrobial and cell lytic activities. J Biol Chem. 1996;271(45):28375-81. Published 1996 Nov 8. doi:10.1074/jbc.271.45.28375

PMID: 8910461

Citation 2: Gillenwaters EN, Seabury CM, Elliott JS, et al. Sequence analysis and polymorphism discovery in 4 members of the bovine cathelicidin gene family. J Hered. 2009;100(2):241-5. Published 2009 Mar-Apr. doi:10.1093/jhered/esn112

PMID: 19136450

Citation 3: Storici P, Tossi A, Lenarcic B, et al. Purification and structural characterization of bovine cathelicidins, precursors of antimicrobial peptides. Eur J Biochem. 1996;238(3):769-76. Published 1996 Jun 15. doi:10.1111/j.1432-1033.1996.0769w.x

PMID: 8706679

5.2 Protein Sequence Databases

UniProt: P54229

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P54229

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X97609	GenBank \|\| EMBL
2.	EU751296	GenBank \|\| EMBL
3.	EU751297	GenBank \|\| EMBL
4.	EU751302	GenBank \|\| EMBL
5.	BC142015	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_776935.1

5.5 Protein-Protein Interaction Databases

STRING: 9913.ENSBTAP00000017763

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001894, IPR018216, IPR046350

PANTHER: PTHR10206

PROSITE: PS00946, PS00947

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: bta:282167

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download