AMPDB_3843 | Cathelicidin-6

PEPTIDE SUMMARY

Cathelicidin-6

1 General Description

AMPDB ID: AMPDB_3843

Protein Names: Cathelicidin-6 (Antibacterial peptide BMAP-27) (Myeloid antibacterial peptide 27)

Protein Family: Cathelicidin family

Gene Name: CATHL6 BMAP27

Source Organism: Bos taurus (Bovine)

Protein Length: 158 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

METQRASLSLGRWSLWLLLLGLALPSASAQALSYREAVLRAVDQFNERSSEANLYRLLELDPPPKEDDENPNIPKPVSFRVKETVCPRTSQQPAEQCDFKENGLVKQCVGTVTLDAVKGKINVTCEELQSVGRFKRFRKKFKKLFKKLSPVIPLLHLG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 10, 'R': 11, 'N': 6, 'D': 6, 'C': 4, 'Q': 8, 'E': 12, 'G': 7, 'H': 1, 'I': 3, 'L': 23, 'K': 14, 'M': 1, 'F': 7, 'P': 11, 'S': 12, 'T': 6, 'W': 2, 'Y': 2, 'V': 12

Frequencies of Amino Acids

'A': 6.33%, 'R': 6.96%, 'N': 3.8%, 'D': 3.8%, 'C': 2.53%, 'Q': 5.06%, 'E': 7.59%, 'G': 4.43%, 'H': 0.63%, 'I': 1.9%, 'L': 14.56%, 'K': 8.86%, 'M': 0.63%, 'F': 4.43%, 'P': 6.96%, 'S': 7.59%, 'T': 3.8%, 'W': 1.27%, 'Y': 1.27%, 'V': 7.59%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, M

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	17851.7 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	92.532	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	37.244	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.361	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.825	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.865	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	6.859	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.31, 0.228, 0.291 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.07	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	13980, 14230	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Staphylococcus aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-MRSA, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Skerlavaj B, Gennaro R, Bagella L, et al. Biological characterization of two novel cathelicidin-derived peptides and identification of structural requirements for their antimicrobial and cell lytic activities. J Biol Chem. 1996;271(45):28375-81. Published 1996 Nov 8. doi:10.1074/jbc.271.45.28375

PMID: 8910461

Citation 2: Gillenwaters EN, Seabury CM, Elliott JS, et al. Sequence analysis and polymorphism discovery in 4 members of the bovine cathelicidin gene family. J Hered. 2009;100(2):241-5. Published 2009 Mar-Apr. doi:10.1093/jhered/esn112

PMID: 19136450

5.2 Protein Sequence Databases

UniProt: P54228

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P54228

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X97608	GenBank \|\| EMBL
2.	EU751305	GenBank \|\| EMBL
3.	EU751306	GenBank \|\| EMBL
4.	EU751311	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_777257.1

5.5 Protein-Protein Interaction Databases

STRING: 9913.ENSBTAP00000042250

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001894, IPR018216, IPR046350

PANTHER: PTHR10206

PROSITE: PS00946, PS00947

5.8 Genome Annotation Databases

Ensembl: ENSGT00390000000410

KEGG: bta:317651

5.9 Phylogenomic Databases

GeneTree: ENSGT00390000000410

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download