AMPDB_3830 | Antibacterial peptide PMAP-36

PEPTIDE SUMMARY

Antibacterial peptide PMAP-36

1 General Description

AMPDB ID: AMPDB_3830

Protein Names: Antibacterial peptide PMAP-36 (Myeloid antibacterial peptide 36)

Protein Family: Cathelicidin family

Gene Name: PMAP36

Source Organism: Sus scrofa (Pig)

Protein Length: 166 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

METQRASLCLGRWSLWLLLLGLVVPSASAQALSYREAVLRAVDRLNEQSSEANLYRLLELDQPPKADEDPGTPKPVSFTVKETVCPRPTWRPPELCDFKENGRVKQCVGTVTLNPSNDPLDINCDEIQSVGRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 8, 'R': 15, 'N': 6, 'D': 8, 'C': 6, 'Q': 6, 'E': 10, 'G': 10, 'H': 0, 'I': 6, 'L': 22, 'K': 12, 'M': 1, 'F': 3, 'P': 15, 'S': 11, 'T': 8, 'W': 4, 'Y': 2, 'V': 13

Frequencies of Amino Acids

'A': 4.82%, 'R': 9.04%, 'N': 3.61%, 'D': 4.82%, 'C': 3.61%, 'Q': 3.61%, 'E': 6.02%, 'G': 6.02%, 'H': 0%, 'I': 3.61%, 'L': 13.25%, 'K': 7.23%, 'M': 0.6%, 'F': 1.81%, 'P': 9.04%, 'S': 6.63%, 'T': 4.82%, 'W': 2.41%, 'Y': 1.2%, 'V': 7.83%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	18646.7 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	93.313	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	36.579	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.38	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.775	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.927	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	8.642	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.301, 0.253, 0.247 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.054	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	24980, 25355	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Storici P, Scocchi M, Tossi A, et al. Chemical synthesis and biological activity of a novel antibacterial peptide deduced from a pig myeloid cDNA. FEBS Lett. 1994;337(3):303-7. Published 1994 Jan 17. doi:10.1016/0014-5793(94)80214-9

PMID: 8293820

5.2 Protein Sequence Databases

UniProt: P49931

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P49931

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	L29125	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_001123437.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001894, IPR018216, IPR046350

PANTHER: PTHR10206

PROSITE: PS00946, PS00947

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: ssc:100170124

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download