AMPDB_3820 | Beta-defensin 12

PEPTIDE SUMMARY

Beta-defensin 12

1 General Description

AMPDB ID: AMPDB_3820

Protein Names: Beta-defensin 12 (BNBD-12) (BNDB-12)

Protein Family: Beta-defensin family

Gene Name: DEFB12

Source Organism: Bos taurus (Bovine)

Protein Length: 38 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

GPLSCGRNGGVCIPIRCPVPMRQIGTCFGRPVKCCRSW

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 0, 'R': 5, 'N': 1, 'D': 0, 'C': 6, 'Q': 1, 'E': 0, 'G': 6, 'H': 0, 'I': 3, 'L': 1, 'K': 1, 'M': 1, 'F': 1, 'P': 5, 'S': 2, 'T': 1, 'W': 1, 'Y': 0, 'V': 3

Frequencies of Amino Acids

'A': 0%, 'R': 13.16%, 'N': 2.63%, 'D': 0%, 'C': 15.79%, 'Q': 2.63%, 'E': 0%, 'G': 15.79%, 'H': 0%, 'I': 7.89%, 'L': 2.63%, 'K': 2.63%, 'M': 2.63%, 'F': 2.63%, 'P': 13.16%, 'S': 5.26%, 'T': 2.63%, 'W': 2.63%, 'Y': 0%, 'V': 7.89%

Missing Amino Acid(s)

A, D, E, H, Y

Most Occurring Amino Acid(s)

C, G

Less Occurring Amino Acid(s)

F, K, L, M, N, Q, T, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	4105.97 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	63.947	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	55.111	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.068	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.691	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.277	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	5.626	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.237, 0.368, 0.053 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.053	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5875	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Selsted ME, Tang YQ, Morris WL, et al. Purification, primary structures, and antibacterial activities of beta-defensins, a new family of antimicrobial peptides from bovine neutrophils. J Biol Chem. 1993;268(9):6641-8. Published 1993 Mar 25. doi:

PMID: 8454635

Citation 2: Tang YQ, Selsted ME, Selsted ME. Characterization of the disulfide motif in BNBD-12, an antimicrobial beta-defensin peptide from bovine neutrophils. J Biol Chem. 1993;268(9):6649-53. Published 1993 Mar 25. doi:

PMID: 8454636

Citation 3: Zimmermann GR, Legault P, Selsted ME, et al. Solution structure of bovine neutrophil beta-defensin-12: the peptide fold of the beta-defensins is identical to that of the classical defensins. Biochemistry. 1995;34(41):13663-71. Published 1995 Oct 17. doi:10.1021/bi00041a048

PMID: 7577957

5.2 Protein Sequence Databases

UniProt: P46170

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P46170

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR006080, IPR001855

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download