AMPDB_382 | Lactose-binding lectin l-2

PEPTIDE SUMMARY

Lactose-binding lectin l-2

1 General Description

AMPDB ID: AMPDB_382

Protein Names: Lactose-binding lectin l-2 (Ajl-2)

Protein Family: Nil

Gene Name: l-2

Source Organism: Anguilla japonica (Japanese eel)

Protein Length: 166 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MVSFKLPAFLCVAVLSSMALVSHGAVLGLCEGACPEGWVEHKNRCYLHVAEKKTWLDAELNCLHHGGNLASEHSEDEHQFLKDLHKGSDDPFWIGLSAVHEGRSWLWSDGTSASAEGDFSMWNPGEPNDAGGKEDCVHDNYGGQKHWNDIKCDLLFPSICVLRMVE

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 12, 'R': 3, 'N': 7, 'D': 12, 'C': 8, 'Q': 2, 'E': 13, 'G': 16, 'H': 11, 'I': 3, 'L': 18, 'K': 9, 'M': 4, 'F': 6, 'P': 6, 'S': 14, 'T': 2, 'W': 7, 'Y': 2, 'V': 11

Frequencies of Amino Acids

'A': 7.23%, 'R': 1.81%, 'N': 4.22%, 'D': 7.23%, 'C': 4.82%, 'Q': 1.2%, 'E': 7.83%, 'G': 9.64%, 'H': 6.63%, 'I': 1.81%, 'L': 10.84%, 'K': 5.42%, 'M': 2.41%, 'F': 3.61%, 'P': 3.61%, 'S': 8.43%, 'T': 1.2%, 'W': 4.22%, 'Y': 1.2%, 'V': 6.63%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Q, T, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	18362.6 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	75.783	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	31.36	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.278	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.635	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	5.006	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-12.474	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.283, 0.259, 0.283 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.09	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	41480, 41980	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Lectin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Tasumi S, Ohira T, Kawazoe I, et al. Primary structure and characteristics of a lectin from skin mucus of the Japanese eel Anguilla japonica. J Biol Chem. 2002;277(30):27305-11. Published 2002 Jul 26. doi:10.1074/jbc.M202648200

PMID: 11959866

5.2 Protein Sequence Databases

UniProt: Q90WJ8

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q90WJ8

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AB050703	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001304, IPR016186, IPR018378, IPR016187

PANTHER: Not found

PROSITE: PS00615, PS50041

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download