AMPDB_3816 | Beta-defensin 2

PEPTIDE SUMMARY

Beta-defensin 2

1 General Description

AMPDB ID: AMPDB_3816

Protein Names: Beta-defensin 2 (BNBD-2) (BNDB-2)

Protein Family: Beta-defensin family

Gene Name: DEFB2

Source Organism: Bos taurus (Bovine)

Protein Length: 40 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

VRNHVTCRINRGFCVPIRCPGRTRQIGTCFGPRIKCCRSW

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 0, 'R': 8, 'N': 2, 'D': 0, 'C': 6, 'Q': 1, 'E': 0, 'G': 4, 'H': 1, 'I': 4, 'L': 0, 'K': 1, 'M': 0, 'F': 2, 'P': 3, 'S': 1, 'T': 3, 'W': 1, 'Y': 0, 'V': 3

Frequencies of Amino Acids

'A': 0%, 'R': 20%, 'N': 5%, 'D': 0%, 'C': 15%, 'Q': 2.5%, 'E': 0%, 'G': 10%, 'H': 2.5%, 'I': 10%, 'L': 0%, 'K': 2.5%, 'M': 0%, 'F': 5%, 'P': 7.5%, 'S': 2.5%, 'T': 7.5%, 'W': 2.5%, 'Y': 0%, 'V': 7.5%

Missing Amino Acid(s)

A, D, E, L, M, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, K, Q, S, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	4648.55 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	60.75	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	26.005	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.315	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.761	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.709	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	8.717	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.25, 0.25, 0 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.075	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5875	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Selsted ME, Tang YQ, Morris WL, et al. Purification, primary structures, and antibacterial activities of beta-defensins, a new family of antimicrobial peptides from bovine neutrophils. J Biol Chem. 1993;268(9):6641-8. Published 1993 Mar 25. doi:

PMID: 8454635

5.2 Protein Sequence Databases

UniProt: P46160

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P46160

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR006080, IPR001855

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download