AMPDB_3815 | Lantibiotic mersacidin

1 General Description

AMPDB ID: AMPDB_3815

Protein Names: Lantibiotic mersacidin

Protein Family: Type B lantibiotic family

Gene Name: mrsA

Source Organism: Bacillus sp. (strain HIL-Y85 54728)

Protein Length: 68 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MSQEAIIRSWKDPFSRENSTQNPAGNPFSELKEAQMDKLVGAGDMEAACTFTLPGGGGVCTLTSECIC

FASTA format

Counts of Amino Acids

'A': 6, 'R': 2, 'N': 3, 'D': 3, 'C': 4, 'Q': 3, 'E': 6, 'G': 7, 'H': 0, 'I': 3, 'L': 4, 'K': 3, 'M': 3, 'F': 3, 'P': 4, 'S': 6, 'T': 5, 'W': 1, 'Y': 0, 'V': 2

Frequencies of Amino Acids

'A': 8.82%, 'R': 2.94%, 'N': 4.41%, 'D': 4.41%, 'C': 5.88%, 'Q': 4.41%, 'E': 8.82%, 'G': 10.29%, 'H': 0%, 'I': 4.41%, 'L': 5.88%, 'K': 4.41%, 'M': 4.41%, 'F': 4.41%, 'P': 5.88%, 'S': 8.82%, 'T': 7.35%, 'W': 1.47%, 'Y': 0%, 'V': 2.94%

Missing Amino Acid(s)

H, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7228.13 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	57.5	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	68.591	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.288	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.775	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.173	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-4.239	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.191, 0.294, 0.279 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.059	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5750	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Lantibiotic, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Bierbaum G, BrÃ¶tz H, Koller KP, et al. Cloning, sequencing and production of the lantibiotic mersacidin. FEMS Microbiol Lett. 1995;127(1-2):121-6. Published 1995 Mar 15. doi:10.1111/j.1574-6968.1995.tb07460.x

PMID: 7737474

Citation 2: Altena K, Guder A, Cramer C, et al. Biosynthesis of the lantibiotic mersacidin: organization of a type B lantibiotic gene cluster. Appl Environ Microbiol. 2000;66(6):2565-71. Published 2000 Jun. doi:10.1128/AEM.66.6.2565-2571.2000

PMID: 10831439

Citation 3: BrÃ¶tz H, Bierbaum G, Reynolds PE, et al. The lantibiotic mersacidin inhibits peptidoglycan biosynthesis at the level of transglycosylation. Eur J Biochem. 1997;246(1):193-9. Published 1997 May 15. doi:10.1111/j.1432-1033.1997.t01-1-00193.x

PMID: 9210483

Citation 4: Prasch T, Naumann T, Markert RL, et al. Constitution and solution conformation of the antibiotic mersacidin determined by NMR and molecular dynamics. Eur J Biochem. 1997;244(2):501-12. Published 1997 Mar 1. doi:10.1111/j.1432-1033.1997.00501.x

PMID: 9119018

Citation 5: Schneider TR, KÃ¤rcher J, Pohl E, et al. Ab initio structure determination of the lantibiotic mersacidin. Acta Crystallogr D Biol Crystallogr. 2000;56(Pt 6):705-13. Published 2000 Jun. doi:10.1107/s0907444900003711

PMID: 10818347

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P43683

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	Z47559	GenBank \|\| EMBL
2.	AJ250862	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: DB02688, DB01968, DB04454

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR027635

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download