AMPDB_3805 | Bacteriocin carnobacteriocin BM1

PEPTIDE SUMMARY

Bacteriocin carnobacteriocin BM1

1 General Description

AMPDB ID: AMPDB_3805

Protein Names: Bacteriocin carnobacteriocin BM1 (Carnobacteriocin B1)

Protein Family: Bacteriocin class IIA YGNGV family

Gene Name: cbnBM1

Source Organism: Carnobacterium maltaromaticum (Carnobacterium piscicola)

Protein Length: 61 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKSVKELNKKEMQQINGGAISYGNGVYCNKEKCWVNKAENKQAITGIVIGGWASSLAGMGH

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 5, 'R': 0, 'N': 6, 'D': 0, 'C': 2, 'Q': 3, 'E': 4, 'G': 9, 'H': 1, 'I': 5, 'L': 2, 'K': 8, 'M': 3, 'F': 0, 'P': 0, 'S': 4, 'T': 1, 'W': 2, 'Y': 2, 'V': 4

Frequencies of Amino Acids

'A': 8.2%, 'R': 0%, 'N': 9.84%, 'D': 0%, 'C': 3.28%, 'Q': 4.92%, 'E': 6.56%, 'G': 14.75%, 'H': 1.64%, 'I': 8.2%, 'L': 3.28%, 'K': 13.11%, 'M': 4.92%, 'F': 0%, 'P': 0%, 'S': 6.56%, 'T': 1.64%, 'W': 3.28%, 'Y': 3.28%, 'V': 6.56%

Missing Amino Acid(s)

D, F, P, R

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6571.58 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	71.967	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	25.433	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.413	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.479	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.713	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	3.968	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.246, 0.311, 0.23 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.066	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	13980, 14105	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Listeria (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-listeria, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Quadri LE, Sailer M, Roy KL, et al. Chemical and genetic characterization of bacteriocins produced by Carnobacterium piscicola LV17B. J Biol Chem. 1994;269(16):12204-11. Published 1994 Apr 22. doi:

PMID: 8163526

5.2 Protein Sequence Databases

UniProt: P38579

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P38579

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	L29058	GenBank \|\| EMBL

CCDS: Not found

RefSeq: WP_010051997.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR002633, IPR023384, IPR023388, IPR010133

PANTHER: Not found

PROSITE: PS60030

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download