AMPDB_3795 | Lantibiotic salivaricin-A

PEPTIDE SUMMARY

Lantibiotic salivaricin-A

1 General Description

AMPDB ID: AMPDB_3795

Protein Names: Lantibiotic salivaricin-A

Protein Family: Type A lantibiotic family

Gene Name: salA

Source Organism: Streptococcus salivarius

Protein Length: 48 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKNSKDILNNAIEEVSEKELMEVAGGKRGSGWIATITDDCPNSVFVCC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 1, 'N': 4, 'D': 3, 'C': 3, 'Q': 0, 'E': 5, 'G': 4, 'H': 0, 'I': 4, 'L': 2, 'K': 4, 'M': 2, 'F': 1, 'P': 1, 'S': 4, 'T': 2, 'W': 1, 'Y': 0, 'V': 4

Frequencies of Amino Acids

'A': 6.25%, 'R': 2.08%, 'N': 8.33%, 'D': 6.25%, 'C': 6.25%, 'Q': 0%, 'E': 10.42%, 'G': 8.33%, 'H': 0%, 'I': 8.33%, 'L': 4.17%, 'K': 8.33%, 'M': 4.17%, 'F': 2.08%, 'P': 2.08%, 'S': 8.33%, 'T': 4.17%, 'W': 2.08%, 'Y': 0%, 'V': 8.33%

Missing Amino Acid(s)

H, Q, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

F, P, R, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	5203.92 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	79.167	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	46.171	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.185	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.566	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.29	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-3.179	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.25, 0.271, 0.25 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.042	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5625	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Lantibiotic, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Ross KF, Ronson CW, Tagg JR, et al. Isolation and characterization of the lantibiotic salivaricin A and its structural gene salA from Streptococcus salivarius 20P3. Appl Environ Microbiol. 1993;59(7):2014-21. Published 1993 Jul. doi:10.1128/aem.59.7.2014-2021.1993

PMID: 8357242

5.2 Protein Sequence Databases

UniProt: P36500

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P36500

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AY005472	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR007682

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download