AMPDB_3791 | Bacteriocin sakacin-P

1 General Description

AMPDB ID: AMPDB_3791

Protein Names: Bacteriocin sakacin-P (Sakacin 674)

Protein Family: Bacteriocin class IIA YGNGV family

Gene Name: sakP sakR sppA

Source Organism: Latilactobacillus sakei (Lactobacillus sakei)

Protein Length: 61 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MEKFIELSLKEVTAITGGKYYGNGVHCGKHSCTVDWGTAIGNIGNNAAANWATGGNAGWNK

FASTA format

Counts of Amino Acids

'A': 7, 'R': 0, 'N': 7, 'D': 1, 'C': 2, 'Q': 0, 'E': 3, 'G': 11, 'H': 2, 'I': 4, 'L': 2, 'K': 5, 'M': 1, 'F': 1, 'P': 0, 'S': 2, 'T': 5, 'W': 3, 'Y': 2, 'V': 3

Frequencies of Amino Acids

'A': 11.48%, 'R': 0%, 'N': 11.48%, 'D': 1.64%, 'C': 3.28%, 'Q': 0%, 'E': 4.92%, 'G': 18.03%, 'H': 3.28%, 'I': 6.56%, 'L': 3.28%, 'K': 8.2%, 'M': 1.64%, 'F': 1.64%, 'P': 0%, 'S': 3.28%, 'T': 8.2%, 'W': 4.92%, 'Y': 3.28%, 'V': 4.92%

Missing Amino Acid(s)

P, Q, R

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, F, M

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6385.13 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	64.098	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	21.434	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.307	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.513	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.229	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	1.058	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.246, 0.328, 0.213 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.098	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	19480, 19605	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Carnobacterium (Gram-positive), Enterococcus faecalis (Gram-positive), Listeria monocytogenes (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-listeria, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Tichaczek PS, Vogel RF, Hammes WP, et al. Cloning and sequencing of sakP encoding sakacin P, the bacteriocin produced by Lactobacillus sake LTH 673. Microbiology (Reading). 1994;140 ( Pt 2):361-7. Published 1994 Feb. doi:10.1099/13500872-140-2-361

PMID: 8180701

Citation 2: Holck AL, Axelsson L, HÃ¼hne K, et al. Purification and cloning of sakacin 674, a bacteriocin from Lactobacillus sake Lb674. FEMS Microbiol Lett. 1994;115(2-3):143-9. Published 1994 Jan 15. doi:10.1111/j.1574-6968.1994.tb06629.x

PMID: 8138128

Citation 3: HÃ¼hne K, Axelsson L, Holck A, et al. Analysis of the sakacin P gene cluster from Lactobacillus sake Lb674 and its expression in sakacin-negative Lb. sake strains. Microbiology (Reading). 1996;142 ( Pt 6):1437-1448. Published 1996 Jun. doi:10.1099/13500872-142-6-1437

PMID: 8704983

Citation 4: Uteng M, Hauge HH, Markwick PR, et al. Three-dimensional structure in lipid micelles of the pediocin-like antimicrobial peptide sakacin P and a sakacin P variant that is structurally stabilized by an inserted C-terminal disulfide bridge. Biochemistry. 2003;42(39):11417-26. Published 2003 Oct 7. doi:10.1021/bi034572i

PMID: 14516192

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P35618

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X75081	GenBank \|\| EMBL
2.	Z25816	GenBank \|\| EMBL
3.	Z48542	GenBank \|\| EMBL
4.	AF002276	GenBank \|\| EMBL

RefSeq: WP_004271264.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR002633, IPR023384, IPR023388

PANTHER: Not found

PROSITE: PS60030

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download