AMPDB_3790 | Apidaecins type 22

PEPTIDE SUMMARY

Apidaecins type 22

1 General Description

AMPDB ID: AMPDB_3790

Protein Names: Apidaecins type 22 [Cleaved into: Apidaecin-1B (Apidaecin IB); Apidaecin-1A (Apidaecin IA)]

Protein Family: Apidaecin family

Gene Name: Nil

Source Organism: Apis mellifera (Honeybee)

Protein Length: 144 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKNFALAILVVTFVVAVFGNTNLDPPTRPTRLRREAEPEAEPGNNRPVYIPQPRPPHPRLRREAEPEAEPGNNRPVYIPQPRPPHPRLRREAEPEAEPGNNRPVYIPQPRPPHPRLRREAEPEAEPGNNRPVYIPQPRPPHPRI

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 11, 'R': 22, 'N': 11, 'D': 1, 'C': 0, 'Q': 4, 'E': 16, 'G': 5, 'H': 4, 'I': 6, 'L': 7, 'K': 1, 'M': 1, 'F': 3, 'P': 35, 'S': 0, 'T': 4, 'W': 0, 'Y': 4, 'V': 9

Frequencies of Amino Acids

'A': 7.64%, 'R': 15.28%, 'N': 7.64%, 'D': 0.69%, 'C': 0%, 'Q': 2.78%, 'E': 11.11%, 'G': 3.47%, 'H': 2.78%, 'I': 4.17%, 'L': 4.86%, 'K': 0.69%, 'M': 0.69%, 'F': 2.08%, 'P': 24.31%, 'S': 0%, 'T': 2.78%, 'W': 0%, 'Y': 2.78%, 'V': 6.25%

Missing Amino Acid(s)

C, S, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, K, M

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	16538.8 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	60.972	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	69.591	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-1.196	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.503	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.054	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	6.387	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.201, 0.354, 0.243 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.049	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5960, 5960	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Casteels-Josson K, Capaci T, Casteels P, et al. Apidaecin multipeptide precursor structure: a putative mechanism for amplification of the insect antibacterial response. EMBO J. 1993;12(4):1569-78. Published 1993 Apr. doi:10.1002/j.1460-2075.1993.tb05801.x

PMID: 8467807

Citation 2: Casteels P, Ampe C, Jacobs F, et al. Apidaecins: antibacterial peptides from honeybees. EMBO J. 1989;8(8):2387-91. Published 1989 Aug. doi:10.1002/j.1460-2075.1989.tb08368.x

PMID: 2676519

Citation 3: Casteels P, Romagnolo J, Castle M, et al. Biodiversity of apidaecin-type peptide antibiotics. Prospects of manipulating the antibacterial spectrum and combating acquired resistance. J Biol Chem. 1994;269(42):26107-15. Published 1994 Oct 21. doi:

PMID: 7929322

5.2 Protein Sequence Databases

UniProt: P35581

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P35581

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X72576	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_001011642.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR004828

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download