AMPDB_379 | Lysozyme A

PEPTIDE SUMMARY

Lysozyme A

1 General Description

AMPDB ID: AMPDB_379

Protein Names: Lysozyme A (EC 3.2.1.n3) (1;4-beta-N-acetylmuramidase A)

Protein Family: Dictyostelium lysozyme family

Gene Name: alyA DDB_G0275123

Source Organism: Dictyostelium discoideum (Slime mold)

Protein Length: 181 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MRIAFFLLVLAVIIGFAYGYSCPKPCYGNMCCSTSPNNQYYLTDFCGSTSACGPVPSCSGALYFTADSQRFGCGKYLNLCRSGKCVKAQIYDAGPAMWVEQDAGMMIIDASPTICHVLTGGSSCGWSDHFLITATVTSLTDSRPLGPFNVTESEMAQLFIDHEIAMAQCEAEKTCNGFDLE

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 16, 'R': 4, 'N': 6, 'D': 9, 'C': 14, 'Q': 6, 'E': 7, 'G': 16, 'H': 3, 'I': 10, 'L': 13, 'K': 5, 'M': 7, 'F': 10, 'P': 9, 'S': 16, 'T': 12, 'W': 2, 'Y': 8, 'V': 8

Frequencies of Amino Acids

'A': 8.84%, 'R': 2.21%, 'N': 3.31%, 'D': 4.97%, 'C': 7.73%, 'Q': 3.31%, 'E': 3.87%, 'G': 8.84%, 'H': 1.66%, 'I': 5.52%, 'L': 7.18%, 'K': 2.76%, 'M': 3.87%, 'F': 5.52%, 'P': 4.97%, 'S': 8.84%, 'T': 6.63%, 'W': 1.1%, 'Y': 4.42%, 'V': 4.42%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

A, G, S

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	19526.3 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	71.216	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	40.729	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.187	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.468	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.483	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-7.589	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.282, 0.26, 0.238 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.11	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	22920, 23795	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.megaterium, B.subtilis (Gram-positive), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriolytic enzyme, Anti-gram-Positive

4.3 Enzymatic Activity

Glycosidase, Hydrolase

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: GlÃ¶ckner G, Eichinger L, Szafranski K, et al. Sequence and analysis of chromosome 2 of Dictyostelium discoideum. Nature. 2002;418(6893):79-85. Published 2002 Jul 4. doi:10.1038/nature00847

PMID: 12097910

Citation 2: Eichinger L, Pachebat JA, GlÃ¶ckner G, et al. The genome of the social amoeba Dictyostelium discoideum. Nature. 2005;435(7038):43-57. Published 2005 May 5. doi:10.1038/nature03481

PMID: 15875012

Citation 3: Urushihara H, Morio T, Saito T, et al. Analyses of cDNAs from growth and slug stages of Dictyostelium discoideum. Nucleic Acids Res. 2004;32(5):1647-53. Published 2004. doi:10.1093/nar/gkh262

PMID: 15010511

Citation 4: MÃ¼ller I, Subert N, Otto H, et al. A Dictyostelium mutant with reduced lysozyme levels compensates by increased phagocytic activity. J Biol Chem. 2005;280(11):10435-43. Published 2005 Mar 18. doi:10.1074/jbc.M411445200

PMID: 15640146

5.2 Protein Sequence Databases

UniProt: Q8T1G4

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q8T1G4

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AAFI02000013	GenBank \|\| EMBL
2.	C92846	GenBank \|\| EMBL

CCDS: Not found

RefSeq: XP_643739.1

5.5 Protein-Protein Interaction Databases

STRING: 44689.DDB0231275

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: ddi:DDB_G0275123

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download