AMPDB_3783 | Protegrin-2

PEPTIDE SUMMARY

Protegrin-2

1 General Description

AMPDB ID: AMPDB_3783

Protein Names: Protegrin-2 (PG-2)

Protein Family: Cathelicidin family

Gene Name: NPG2

Source Organism: Sus scrofa (Pig)

Protein Length: 147 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

METQRASLCLGRWSLWLLLLALVVPSASAQALSYREAVLRAVDRLNEQSSEANLYRLLELDQPPKADEDPGTPKPVSFTVKETVCPRPTRQPPELCDFKENGRVKQCVGTVTLDQIKDPLDITCNEVQGVRGGRLCYCRRRFCICVG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 9, 'R': 14, 'N': 4, 'D': 8, 'C': 9, 'Q': 8, 'E': 10, 'G': 8, 'H': 0, 'I': 3, 'L': 19, 'K': 6, 'M': 1, 'F': 3, 'P': 11, 'S': 8, 'T': 8, 'W': 2, 'Y': 3, 'V': 13

Frequencies of Amino Acids

'A': 6.12%, 'R': 9.52%, 'N': 2.72%, 'D': 5.44%, 'C': 6.12%, 'Q': 5.44%, 'E': 6.8%, 'G': 5.44%, 'H': 0%, 'I': 2.04%, 'L': 12.93%, 'K': 4.08%, 'M': 0.68%, 'F': 2.04%, 'P': 7.48%, 'S': 5.44%, 'T': 5.44%, 'W': 1.36%, 'Y': 2.04%, 'V': 8.84%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	16478 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	90.136	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	38.484	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.276	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.775	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.901	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	1.457	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.293, 0.211, 0.265 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.054	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	15470, 15970	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

C.albicans, E.coli (Gram-negative), Listeria monocytogenes (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-candida, Anti-listeria, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Storici P, Zanetti M, Zanetti M. A novel cDNA sequence encoding a pig leukocyte antimicrobial peptide with a cathelin-like pro-sequence. Biochem Biophys Res Commun. 1993;196(3):1363-8. Published 1993 Nov 15. doi:10.1006/bbrc.1993.2403

PMID: 8250892

Citation 2: Kokryakov VN, Harwig SS, Panyutich EA, et al. Protegrins: leukocyte antimicrobial peptides that combine features of corticostatic defensins and tachyplesins. FEBS Lett. 1993;327(2):231-6. Published 1993 Jul 26. doi:10.1016/0014-5793(93)80175-t

PMID: 8335113

5.2 Protein Sequence Databases

UniProt: P32195

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P32195

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	L24745	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_001123438.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001894, IPR018216, IPR046350

PANTHER: PTHR10206

PROSITE: PS00946, PS00947

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download