AMPDB_3780 | Sapecin-B

PEPTIDE SUMMARY

Sapecin-B

1 General Description

AMPDB ID: AMPDB_3780

Protein Names: Sapecin-B

Protein Family: Invertebrate defensin family; Type 1 subfamily

Gene Name: Nil

Source Organism: Sarcophaga peregrina (Flesh fly) (Boettcherisca peregrina)

Protein Length: 88 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKFLTSLLLLFVVVMVSAVNLSMAKESANQLTERLQELDGAAIQEPAELNRHKRLTCEIDRSLCLLHCRLKGYLRAYCSQQKVCRCVQ

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 7, 'R': 7, 'N': 3, 'D': 2, 'C': 6, 'Q': 6, 'E': 6, 'G': 2, 'H': 2, 'I': 2, 'L': 16, 'K': 5, 'M': 3, 'F': 2, 'P': 1, 'S': 6, 'T': 3, 'W': 0, 'Y': 2, 'V': 7

Frequencies of Amino Acids

'A': 7.95%, 'R': 7.95%, 'N': 3.41%, 'D': 2.27%, 'C': 6.82%, 'Q': 6.82%, 'E': 6.82%, 'G': 2.27%, 'H': 2.27%, 'I': 2.27%, 'L': 18.18%, 'K': 5.68%, 'M': 3.41%, 'F': 2.27%, 'P': 1.14%, 'S': 6.82%, 'T': 3.41%, 'W': 0%, 'Y': 2.27%, 'V': 7.95%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	10040.9 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	110.795	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	45.251	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.106	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.733	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.619	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	3.816	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.33, 0.136, 0.364 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.045	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 3355	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytotoxin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Lee SR, Kurata S, Natori S, et al. Molecular cloning of cDNA for sapecin B, an antibacterial protein of Sarcophaga, and its detection in larval brain. FEBS Lett. 1995;368(3):485-7. Published 1995 Jul 24. doi:10.1016/0014-5793(95)00717-n

PMID: 7635204

Citation 2: Yamada K, Natori S, Natori S. Purification, sequence and antibacterial activity of two novel sapecin homologues from Sarcophaga embryonic cells: similarity of sapecin B to charybdotoxin. Biochem J. 1993;291 ( Pt 1)(Pt 1):275-9. Published 1993 Apr 1. doi:10.1042/bj2910275

PMID: 8471044

5.2 Protein Sequence Databases

UniProt: P31529

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P31529

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	S80571	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001542

PANTHER: Not found

PROSITE: PS51378

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download