AMPDB_3774 | Antimicrobial peptide 2

1 General Description

AMPDB ID: AMPDB_3774

Protein Names: Antimicrobial peptide 2 (AMP2) [Cleaved into: Antimicrobial peptide 1 (AMP1)]

Protein Family: Nil

Gene Name: Nil

Source Organism: Amaranthus caudatus (Love-lies-bleeding) (Inca-wheat)

Protein Length: 86 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MVNMKCVALIVIVMMAFMMVDPSMGVGECVRGRCPSGMCCSQFGYCGKGPKYCGRASTTVDHQADVAATKTAKNPTDAKLAGAGSP

FASTA format

Counts of Amino Acids

'A': 10, 'R': 3, 'N': 2, 'D': 4, 'C': 7, 'Q': 2, 'E': 1, 'G': 10, 'H': 1, 'I': 2, 'L': 2, 'K': 6, 'M': 8, 'F': 2, 'P': 5, 'S': 5, 'T': 5, 'W': 0, 'Y': 2, 'V': 9

Frequencies of Amino Acids

'A': 11.63%, 'R': 3.49%, 'N': 2.33%, 'D': 4.65%, 'C': 8.14%, 'Q': 2.33%, 'E': 1.16%, 'G': 11.63%, 'H': 1.16%, 'I': 2.33%, 'L': 2.33%, 'K': 6.98%, 'M': 9.3%, 'F': 2.33%, 'P': 5.81%, 'S': 5.81%, 'T': 5.81%, 'W': 0%, 'Y': 2.33%, 'V': 10.47%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

A, G

Less Occurring Amino Acid(s)

E, H

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8911.56 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	60.116	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	12.616	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.198	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.546	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.498	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	3.655	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.198, 0.256, 0.244 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.047	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 3355	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Plant defense, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: De Bolle MF, David KM, Rees SB, et al. Cloning and characterization of a cDNA encoding an antimicrobial chitin-binding protein from amaranth, Amaranthus caudatus. Plant Mol Biol. 1993;22(6):1187-90. Published 1993 Sep. doi:10.1007/BF00028991

PMID: 8400136

Citation 2: Broekaert WF, MariÃ«n W, Terras FR, et al. Antimicrobial peptides from Amaranthus caudatus seeds with sequence homology to the cysteine/glycine-rich domain of chitin-binding proteins. Biochemistry. 1992;31(17):4308-14. Published 1992 May 5. doi:10.1021/bi00132a023

PMID: 1567877

Citation 3: Martins JC, Maes D, Loris R, et al. H NMR study of the solution structure of Ac-AMP2, a sugar binding antimicrobial protein isolated from Amaranthus caudatus. J Mol Biol. 1996;258(2):322-33. Published 1996 May 3. doi:10.1006/jmbi.1996.0253

PMID: 8627629

Citation 4: el Bouyoussfi M, Laus G, Verheyden P, et al. Location of the three disulfide bonds in an antimicrobial peptide from Amaranthus caudatus using mass spectrometry. J Pept Res. 1997;49(4):336-40. Published 1997 Apr. doi:10.1111/j.1399-3011.1997.tb01134.x

PMID: 9176817

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P27275

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X72641	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

PANTHER: Not found

PROSITE: PS00026, PS60011

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download