AMPDB_3767 | Antimicrobial protein CAP18

1 General Description

AMPDB ID: AMPDB_3767

Protein Names: Antimicrobial protein CAP18 (18 kDa cationic protein) (18 kDa lipopolysaccharide-binding protein) (CAP18-A) [Cleaved into: Antimicrobial protein CAP7]

Protein Family: Cathelicidin family

Gene Name: CAP18

Source Organism: Oryctolagus cuniculus (Rabbit)

Protein Length: 171 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

METHKHGPSLAWWSLLLLLLGLLMPPAIAQDLTYREAVLRAVDAFNQQSSEANLYRLLSMDPQQLEDAKPYTPQPVSFTVKETECPRTTWKLPEQCDFKEDGLVKRCVGTVTRYQAWDSFDIRCNRAQESPEPTGLRKRLRKFRNKIKEKLKKIGQKIQGFVPKLAPRTDY

FASTA format

Counts of Amino Acids

'A': 11, 'R': 13, 'N': 4, 'D': 9, 'C': 4, 'Q': 11, 'E': 11, 'G': 7, 'H': 2, 'I': 5, 'L': 21, 'K': 15, 'M': 3, 'F': 6, 'P': 13, 'S': 8, 'T': 11, 'W': 4, 'Y': 5, 'V': 8

Frequencies of Amino Acids

'A': 6.43%, 'R': 7.6%, 'N': 2.34%, 'D': 5.26%, 'C': 2.34%, 'Q': 6.43%, 'E': 6.43%, 'G': 4.09%, 'H': 1.17%, 'I': 2.92%, 'L': 12.28%, 'K': 8.77%, 'M': 1.75%, 'F': 3.51%, 'P': 7.6%, 'S': 4.68%, 'T': 6.43%, 'W': 2.34%, 'Y': 2.92%, 'V': 4.68%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	19804.9 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	79.298	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	46.275	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.617	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.722	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.831	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	7.947	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.287, 0.187, 0.269 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.088	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	29450, 29700	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Gram Negative Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Larrick JW, Morgan JG, Palings I, et al. Complementary DNA sequence of rabbit CAP18--a unique lipopolysaccharide binding protein. Biochem Biophys Res Commun. 1991;179(1):170-5. Published 1991 Aug 30. doi:10.1016/0006-291x(91)91350-l

PMID: 1883348

Citation 2: Hirata M, Shimomura Y, Yoshida M, et al. Characterization of a rabbit cationic protein (CAP18) with lipopolysaccharide-inhibitory activity. Infect Immun. 1994;62(4):1421-6. Published 1994 Apr. doi:10.1128/iai.62.4.1421-1426.1994

PMID: 8132348

Citation 3: Larrick JW, Hirata M, Zheng H, et al. A novel granulocyte-derived peptide with lipopolysaccharide-neutralizing activity. J Immunol. 1994;152(1):231-40. Published 1994 Jan 1. doi:

PMID: 8254193

Citation 4: Tossi A, Scocchi M, Skerlavaj B, et al. Identification and characterization of a primary antibacterial domain in CAP18, a lipopolysaccharide binding protein from rabbit leukocytes. FEBS Lett. 1994;339(1-2):108-12. Published 1994 Feb 14. doi:10.1016/0014-5793(94)80395-1

PMID: 8313956

Citation 5: Chen C, Brock R, Luh F, et al. The solution structure of the active domain of CAP18--a lipopolysaccharide binding protein from rabbit leukocytes. FEBS Lett. 1995;370(1-2):46-52. Published 1995 Aug 14. doi:10.1016/0014-5793(95)00792-8

PMID: 7649303

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P25230

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	M73998	GenBank \|\| EMBL

RefSeq: NP_001075774.1

5.5 Protein-Protein Interaction Databases

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

PANTHER: PTHR10206

PROSITE: PS00946, PS00947

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: ocu:100009142

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download