AMPDB_3766 | Tracheal antimicrobial peptide

PEPTIDE SUMMARY

Tracheal antimicrobial peptide

1 General Description

AMPDB ID: AMPDB_3766

Protein Names: Tracheal antimicrobial peptide (TAP)

Protein Family: Beta-defensin family; LAP TAP subfamily

Gene Name: Nil

Source Organism: Bos taurus (Bovine)

Protein Length: 64 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MRLHHLLLALLFLVLSAWSGFTQGVGNPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 5, 'N': 2, 'D': 0, 'C': 6, 'Q': 2, 'E': 0, 'G': 7, 'H': 2, 'I': 3, 'L': 8, 'K': 5, 'M': 2, 'F': 2, 'P': 3, 'S': 4, 'T': 2, 'W': 1, 'Y': 0, 'V': 7

Frequencies of Amino Acids

'A': 4.69%, 'R': 7.81%, 'N': 3.13%, 'D': 0%, 'C': 9.38%, 'Q': 3.13%, 'E': 0%, 'G': 10.94%, 'H': 3.13%, 'I': 4.69%, 'L': 12.5%, 'K': 7.81%, 'M': 3.13%, 'F': 3.13%, 'P': 4.69%, 'S': 6.25%, 'T': 3.13%, 'W': 1.56%, 'Y': 0%, 'V': 10.94%

Missing Amino Acid(s)

D, E, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6953.51 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	103.438	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	18.544	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.431	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.692	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.938	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	9.806	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.328, 0.25, 0.203 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.047	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5875	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Candida albicans, Escherichia coli (Gram-negative), Klebsiella pneumonia (Gram-negative), Pseudomonas (Gram-negative), Staphylococcus aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Diamond G, Zasloff M, Eck H, et al. Tracheal antimicrobial peptide, a cysteine-rich peptide from mammalian tracheal mucosa: peptide isolation and cloning of a cDNA. Proc Natl Acad Sci U S A. 1991;88(9):3952-6. Published 1991 May 1. doi:10.1073/pnas.88.9.3952

PMID: 2023943

Citation 2: Diamond G, Jones DE, Bevins CL, et al. Airway epithelial cells are the site of expression of a mammalian antimicrobial peptide gene. Proc Natl Acad Sci U S A. 1993;90(10):4596-600. Published 1993 May 15. doi:10.1073/pnas.90.10.4596

PMID: 8506305

5.2 Protein Sequence Databases

UniProt: P25068

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P25068

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	M63023	GenBank \|\| EMBL
2.	L13373	GenBank \|\| EMBL
3.	AF014106	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_777201.1

5.5 Protein-Protein Interaction Databases

STRING: 9913.ENSBTAP00000056499

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR006080, IPR001855

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: ENSGT00940000160995

KEGG: bta:286837

5.9 Phylogenomic Databases

GeneTree: ENSGT00940000160995

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download