AMPDB_3764 | Sarcotoxin II-3

PEPTIDE SUMMARY

Sarcotoxin II-3

1 General Description

AMPDB ID: AMPDB_3764

Protein Names: Sarcotoxin II-3

Protein Family: Attacin sarcotoxin-2 family

Gene Name: Nil

Source Organism: Sarcophaga peregrina (Flesh fly) (Boettcherisca peregrina)

Protein Length: 294 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

MKSFVLFAACMAIVALSSLAHAYPQKLPVPIPPPTNPPVAAFHNSVATNSKGGQDVSVKLAATNLGNKHVQPIAEVFAEGNTKGGNVIRGATVGVQGHGLGASVTKSGNGIAESFRKQAEANLRLGDSASLIGKVSQTDTKIKGIDFKPQLSSSSLALQGDRLGASISRDVNRGVSDTLTKSISANVFRNDNHNLDASVFRSDVRQNNGFNFQKTGGMLDYSHANGHGLNAGLTRFSGIGNQANVGGYSTLFRSNDGLTSLKANAGGSQWLSGPFANQRDYSFGLGLSHNAWRG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 30, 'R': 13, 'N': 25, 'D': 13, 'C': 1, 'Q': 13, 'E': 4, 'G': 36, 'H': 8, 'I': 11, 'L': 25, 'K': 15, 'M': 3, 'F': 14, 'P': 11, 'S': 32, 'T': 14, 'W': 2, 'Y': 4, 'V': 20

Frequencies of Amino Acids

'A': 10.2%, 'R': 4.42%, 'N': 8.5%, 'D': 4.42%, 'C': 0.34%, 'Q': 4.42%, 'E': 1.36%, 'G': 12.24%, 'H': 2.72%, 'I': 3.74%, 'L': 8.5%, 'K': 5.1%, 'M': 1.02%, 'F': 4.76%, 'P': 3.74%, 'S': 10.88%, 'T': 4.76%, 'W': 0.68%, 'Y': 1.36%, 'V': 6.8%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

152

Hydrophilic Amino Acid(s) Count

142

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	30694.3 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	77.687	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	22.905	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.271	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.795	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.601	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	11.668	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.259, 0.354, 0.211 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.068	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	16960, 16960	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Kanai A, Natori S, Natori S. Analysis of a gene cluster for sarcotoxin II, a group of antibacterial proteins of Sarcophaga peregrina. Mol Cell Biol. 1990;10(12):6114-22. Published 1990 Dec. doi:10.1128/mcb.10.12.6114-6122.1990

PMID: 2247051

5.2 Protein Sequence Databases

UniProt: P24490

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P24490

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	D90154	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR005521, IPR005520

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download