AMPDB_3761 | Bacteriocin lactacin-F subunit LafA

1 General Description

AMPDB ID: AMPDB_3761

Protein Names: Bacteriocin lactacin-F subunit LafA

Protein Family: Bacteriocin class IIB family

Gene Name: lafA laf LJ_0769

Source Organism: Lactobacillus johnsonii (strain CNCM I-12250 La1 NCC 533)

Protein Length: 75 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MKQFNYLSHKDLAVVVGGRNNWQTNVGGAVGSAMIGATVGGTICGPACAVAGAHYLPILWTAVTAATGGFGKIRK

FASTA format

Counts of Amino Acids

'A': 11, 'R': 2, 'N': 4, 'D': 1, 'C': 2, 'Q': 2, 'E': 0, 'G': 13, 'H': 2, 'I': 4, 'L': 4, 'K': 4, 'M': 2, 'F': 2, 'P': 2, 'S': 2, 'T': 6, 'W': 2, 'Y': 2, 'V': 8

Frequencies of Amino Acids

'A': 14.67%, 'R': 2.67%, 'N': 5.33%, 'D': 1.33%, 'C': 2.67%, 'Q': 2.67%, 'E': 0%, 'G': 17.33%, 'H': 2.67%, 'I': 5.33%, 'L': 5.33%, 'K': 5.33%, 'M': 2.67%, 'F': 2.67%, 'P': 2.67%, 'S': 2.67%, 'T': 8%, 'W': 2.67%, 'Y': 2.67%, 'V': 10.67%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7603.83 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	87.2	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	25.875	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.359	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.397	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.248	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	5.053	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.293, 0.28, 0.227 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.08	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	13980, 14105	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Enterococcus faecalis (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Muriana PM, Klaenhammer TR, Klaenhammer TR. Cloning, phenotypic expression, and DNA sequence of the gene for lactacin F, an antimicrobial peptide produced by Lactobacillus spp. J Bacteriol. 1991;173(5):1779-88. Published 1991 Mar. doi:10.1128/jb.173.5.1779-1788.1991

PMID: 1900281

Citation 2: Fremaux C, Ahn C, Klaenhammer TR, et al. Molecular analysis of the lactacin F operon. Appl Environ Microbiol. 1993;59(11):3906-15. Published 1993 Nov. doi:10.1128/aem.59.11.3906-3915.1993

PMID: 8285694

Citation 3: Pridmore RD, Berger B, Desiere F, et al. The genome sequence of the probiotic intestinal bacterium Lactobacillus johnsonii NCC 533. Proc Natl Acad Sci U S A. 2004;101(8):2512-7. Published 2004 Feb 24. doi:10.1073/pnas.0307327101

PMID: 14983040

Citation 4: Muriana PM, Klaenhammer TR, Klaenhammer TR. Purification and partial characterization of lactacin F, a bacteriocin produced by Lactobacillus acidophilus 11088. Appl Environ Microbiol. 1991;57(1):114-21. Published 1991 Jan. doi:10.1128/aem.57.1.114-121.1991

PMID: 1903624

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: P24022

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	M57961	GenBank \|\| EMBL
2.	AE017198	GenBank \|\| EMBL

RefSeq: WP_011161711.1

5.5 Protein-Protein Interaction Databases

STRING: 257314.LJ_0769

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR019493

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: ljo:LJ_0769

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download