AMPDB_3760 | Bacteriocin lactocin-S

PEPTIDE SUMMARY

Bacteriocin lactocin-S

1 General Description

AMPDB ID: AMPDB_3760

Protein Names: Bacteriocin lactocin-S

Protein Family: Nil

Gene Name: lasA

Source Organism: Latilactobacillus sakei L45 (Lactobacillus sakei)

Protein Length: 68 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKTEKKVLDELSLHASAKMGARDVESSMNADSTPVLASVAVSMELLPTASVLYSDVAGCFKYSAKHHC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 9, 'R': 1, 'N': 1, 'D': 4, 'C': 2, 'Q': 0, 'E': 4, 'G': 2, 'H': 3, 'I': 0, 'L': 7, 'K': 6, 'M': 4, 'F': 1, 'P': 2, 'S': 10, 'T': 3, 'W': 0, 'Y': 2, 'V': 7

Frequencies of Amino Acids

'A': 13.24%, 'R': 1.47%, 'N': 1.47%, 'D': 5.88%, 'C': 2.94%, 'Q': 0%, 'E': 5.88%, 'G': 2.94%, 'H': 4.41%, 'I': 0%, 'L': 10.29%, 'K': 8.82%, 'M': 5.88%, 'F': 1.47%, 'P': 2.94%, 'S': 14.71%, 'T': 4.41%, 'W': 0%, 'Y': 2.94%, 'V': 10.29%

Missing Amino Acid(s)

I, Q, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

F, N, R

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7258.35 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	83.235	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	25.685	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.028	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.567	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	6.776	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-0.848	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.25, 0.221, 0.353 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.044	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 3105	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Lactobacillus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Lantibiotic, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Skaugen M, Nissen-Meyer J, Jung G, et al. In vivo conversion of L-serine to D-alanine in a ribosomally synthesized polypeptide. J Biol Chem. 1994;269(44):27183-5. Published 1994 Nov 4. doi:

PMID: 7961627

Citation 2: MÃ¸rtvedt CI, Nissen-Meyer J, Sletten K, et al. Purification and amino acid sequence of lactocin S, a bacteriocin produced by Lactobacillus sake L45. Appl Environ Microbiol. 1991;57(6):1829-34. Published 1991 Jun. doi:10.1128/aem.57.6.1829-1834.1991

PMID: 1872611

5.2 Protein Sequence Databases

UniProt: P23826

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P23826

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X79889	GenBank \|\| EMBL
2.	Z54312	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download