AMPDB_3759 | Colicin-V

PEPTIDE SUMMARY

Colicin-V

1 General Description

AMPDB ID: AMPDB_3759

Protein Names: Colicin-V (Microcin-V bacteriocin)

Protein Family: Nil

Gene Name: cvaC

Source Organism: Escherichia coli

Protein Length: 103 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MRTLTLNELDSVSGGASGRDIAMAIGTLSGQFVAGGIGAAAGGVAGGAIYDYASTHKPNPAMSPSGLGGTIKQKPEGIPSEAWNYAAGRLCNWSPNNLSDVCL

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 14, 'R': 3, 'N': 6, 'D': 4, 'C': 2, 'Q': 2, 'E': 3, 'G': 17, 'H': 1, 'I': 6, 'L': 8, 'K': 3, 'M': 3, 'F': 1, 'P': 6, 'S': 10, 'T': 5, 'W': 2, 'Y': 3, 'V': 4

Frequencies of Amino Acids

'A': 13.59%, 'R': 2.91%, 'N': 5.83%, 'D': 3.88%, 'C': 1.94%, 'Q': 1.94%, 'E': 2.91%, 'G': 16.5%, 'H': 0.97%, 'I': 5.83%, 'L': 7.77%, 'K': 2.91%, 'M': 2.91%, 'F': 0.97%, 'P': 5.83%, 'S': 9.71%, 'T': 4.85%, 'W': 1.94%, 'Y': 2.91%, 'V': 3.88%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

F, H

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	10310.6 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	77.864	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	44.401	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.016	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.508	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	5.704	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-1.031	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.233, 0.379, 0.272 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.058	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	15470, 15595	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Gilson L, Mahanty HK, Kolter R, et al. Genetic analysis of an MDR-like export system: the secretion of colicin V. EMBO J. 1990;9(12):3875-84. Published 1990 Dec. doi:10.1002/j.1460-2075.1990.tb07606.x

PMID: 2249654

Citation 2: Otto BR, van Dooren SJ, Nuijens JH, et al. Characterization of a hemoglobin protease secreted by the pathogenic Escherichia coli strain EB1. J Exp Med. 1998;188(6):1091-1103. Published 1998 Sep 21. doi:10.1084/jem.188.6.1091

PMID: 9743528

Citation 3: HÃ¥varstein LS, Holo H, Nes IF, et al. The leader peptide of colicin V shares consensus sequences with leader peptides that are common among peptide bacteriocins produced by gram-positive bacteria. Microbiology (Reading). 1994;140 ( Pt 9):2383-9. Published 1994 Sep. doi:10.1099/13500872-140-9-2383

PMID: 7952189

Citation 4: Fath MJ, Zhang LH, Rush J, et al. Purification and characterization of colicin V from Escherichia coli culture supernatants. Biochemistry. 1994;33(22):6911-7. Published 1994 Jun 7. doi:10.1021/bi00188a021

PMID: 8204625

5.2 Protein Sequence Databases

UniProt: P22522

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P22522

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X57525	GenBank \|\| EMBL
2.	AF062844	GenBank \|\| EMBL
3.	AF062845	GenBank \|\| EMBL
4.	AF062846	GenBank \|\| EMBL
5.	AF062847	GenBank \|\| EMBL
6.	AF062848	GenBank \|\| EMBL
7.	AF062849	GenBank \|\| EMBL
8.	AF062850	GenBank \|\| EMBL
9.	AF062851	GenBank \|\| EMBL
10.	AF062852	GenBank \|\| EMBL
11.	AF062853	GenBank \|\| EMBL
12.	AF062854	GenBank \|\| EMBL
13.	AF062855	GenBank \|\| EMBL
14.	AF062856	GenBank \|\| EMBL
15.	AF062857	GenBank \|\| EMBL
16.	AF062858	GenBank \|\| EMBL
17.	AJ223631	GenBank \|\| EMBL

CCDS: Not found

RefSeq: WP_001259758.1, YP_002527505.1, YP_009070743.1, YP_444120.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR020280

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download