AMPDB_3753 | Lantibiotic Pep5

PEPTIDE SUMMARY

Lantibiotic Pep5

1 General Description

AMPDB ID: AMPDB_3753

Protein Names: Lantibiotic Pep5

Protein Family: Type A lantibiotic family

Gene Name: pepA

Source Organism: Staphylococcus epidermidis

Protein Length: 60 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKNNKNLFDLEIKKETSQNTDELEPQTAGPAIRASVKQCQKTLKATRLFTVSCKGKNGCK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 4, 'R': 2, 'N': 5, 'D': 2, 'C': 3, 'Q': 4, 'E': 4, 'G': 3, 'H': 0, 'I': 2, 'L': 5, 'K': 10, 'M': 1, 'F': 2, 'P': 2, 'S': 3, 'T': 6, 'W': 0, 'Y': 0, 'V': 2

Frequencies of Amino Acids

'A': 6.67%, 'R': 3.33%, 'N': 8.33%, 'D': 3.33%, 'C': 5%, 'Q': 6.67%, 'E': 6.67%, 'G': 5%, 'H': 0%, 'I': 3.33%, 'L': 8.33%, 'K': 16.67%, 'M': 1.67%, 'F': 3.33%, 'P': 3.33%, 'S': 5%, 'T': 10%, 'W': 0%, 'Y': 0%, 'V': 3.33%

Missing Amino Acid(s)

H, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6684.73 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	61.833	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	28.693	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.882	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.566	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.217	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	5.817	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.183, 0.217, 0.233 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.033	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 125	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Lantibiotic, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Kaletta C, Entian KD, Kellner R, et al. Pep5, a new lantibiotic: structural gene isolation and prepeptide sequence. Arch Microbiol. 1989;152(1):16-9. Published 1989. doi:10.1007/BF00447005

PMID: 2764678

Citation 2: Meyer C, Bierbaum G, Heidrich C, et al. Nucleotide sequence of the lantibiotic Pep5 biosynthetic gene cluster and functional analysis of PepP and PepC. Evidence for a role of PepC in thioether formation. Eur J Biochem. 1995;232(2):478-89. Published 1995 Sep 1. doi:10.1111/j.1432-1033.1995.tb20834.x

PMID: 7556197

Citation 3: Weil HP, Beck-Sickinger AG, Metzger J, et al. Biosynthesis of the lantibiotic Pep5. Isolation and characterization of a prepeptide containing dehydroamino acids. Eur J Biochem. 1990;194(1):217-23. Published 1990 Nov 26. doi:10.1111/j.1432-1033.1990.tb19446.x

PMID: 2253617

5.2 Protein Sequence Databases

UniProt: P19578

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P19578

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	L23967	GenBank \|\| EMBL
2.	Z49865	GenBank \|\| EMBL

CCDS: Not found

RefSeq: WP_029376348.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR012519

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download