AMPDB_3749 | Sapecin

PEPTIDE SUMMARY

Sapecin

1 General Description

AMPDB ID: AMPDB_3749

Protein Names: Sapecin

Protein Family: Invertebrate defensin family; Type 1 subfamily

Gene Name: Nil

Source Organism: Sarcophaga peregrina (Flesh fly) (Boettcherisca peregrina)

Protein Length: 94 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKSFIVLAVTLCLAAFFMGQSVASPAAAAEESKFVDGLHALKTIEPELHGRYKRATCDLLSGTGINHSACAAHCLLRGNRGGYCNGKAVCVCRN

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 14, 'R': 5, 'N': 4, 'D': 2, 'C': 7, 'Q': 1, 'E': 4, 'G': 9, 'H': 4, 'I': 3, 'L': 10, 'K': 5, 'M': 2, 'F': 4, 'P': 2, 'S': 6, 'T': 4, 'W': 0, 'Y': 2, 'V': 6

Frequencies of Amino Acids

'A': 14.89%, 'R': 5.32%, 'N': 4.26%, 'D': 2.13%, 'C': 7.45%, 'Q': 1.06%, 'E': 4.26%, 'G': 9.57%, 'H': 4.26%, 'I': 3.19%, 'L': 10.64%, 'K': 5.32%, 'M': 2.13%, 'F': 4.26%, 'P': 2.13%, 'S': 6.38%, 'T': 4.26%, 'W': 0%, 'Y': 2.13%, 'V': 6.38%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9914.55 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	87.34	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	37.601	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.256	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.544	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.505	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	3.933	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.266, 0.223, 0.319 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.064	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 3355	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytotoxin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Matsuyama K, Natori S, Natori S. Molecular cloning of cDNA for sapecin and unique expression of the sapecin gene during the development of Sarcophaga peregrina. J Biol Chem. 1988;263(32):17117-21. Published 1988 Nov 15. doi:

PMID: 3182837

Citation 2: Matsuyama K, Natori S, Natori S. Purification of three antibacterial proteins from the culture medium of NIH-Sape-4, an embryonic cell line of Sarcophaga peregrina. J Biol Chem. 1988;263(32):17112-6. Published 1988 Nov 15. doi:

PMID: 3182836

Citation 3: Kuzuhara T, Nakajima Y, Matsuyama K, et al. Determination of the disulfide array in sapecin, an antibacterial peptide of Sarcophaga peregrina (flesh fly). J Biochem. 1990;107(4):514-8. Published 1990 Apr. doi:10.1093/oxfordjournals.jbchem.a123077

PMID: 2358424

Citation 4: Hanzawa H, Shimada I, Kuzuhara T, et al. 1H nuclear magnetic resonance study of the solution conformation of an antibacterial protein, sapecin. FEBS Lett. 1990;269(2):413-20. Published 1990 Sep 3. doi:10.1016/0014-5793(90)81206-4

PMID: 2401368

5.2 Protein Sequence Databases

UniProt: P18313

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P18313

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	J04053	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR017982, IPR001542, IPR036574

PANTHER: Not found

PROSITE: PS51378

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download