AMPDB_3741 | Sarcotoxin-2A
PEPTIDE SUMMARY
Sarcotoxin-2A
1 General Description
AMPDB ID: AMPDB_3741
Protein Names: Sarcotoxin-2A (Sarcotoxin IIA)
Protein Family: Attacin sarcotoxin-2 family
Gene Name: Nil
Protein Length: 294 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MKSFVFFAACMAIIALSSLVQAYPQKLPVPIPPPTNPPVAAFHNSVATNSKGGQDVSVKLAATNLGNKHVQPIAEVFAEGNTKGGNVLRGATVGVQGHGLGASVTKSQDGIAESFRKQAEANLRLGDSASLIGKVSQTDTKIKGIDFKPQLSSSSLALQGDRLGASISRDVNRGVSDTLTKSVSANLFRNDNHNLDASVFRSDVRQNNGFNFQKTGGMLDYSHANGHGLNAGLTRFSGIGNQATVGGYSTLFRSNDGLTSLKANAGGSQWLSGPFANQRDYSFGLGLSHNAWRG
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 29, 'R': 13, 'N': 23, 'D': 14, 'C': 1, 'Q': 15, 'E': 4, 'G': 35, 'H': 7, 'I': 10, 'L': 26, 'K': 15, 'M': 3, 'F': 15, 'P': 11, 'S': 32, 'T': 15, 'W': 2, 'Y': 4, 'V': 20
Frequencies of Amino Acids
'A': 9.86%, 'R': 4.42%, 'N': 7.82%, 'D': 4.76%, 'C': 0.34%, 'Q': 5.1%, 'E': 1.36%, 'G': 11.9%, 'H': 2.38%, 'I': 3.4%, 'L': 8.84%, 'K': 5.1%, 'M': 1.02%, 'F': 5.1%, 'P': 3.74%, 'S': 10.88%, 'T': 5.1%, 'W': 0.68%, 'Y': 1.36%, 'V': 6.8%
Missing Amino Acid(s)
No Amino Acid(s) are missing in this protein
Most Occurring Amino Acid(s)
G
Less Occurring Amino Acid(s)
C
Hydrophobic Amino Acid(s) Count
151
Hydrophilic Amino Acid(s) Count
143
Basic Amino Acid(s) Count
18
Acidic Amino Acid(s) Count
35
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 30820.5 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 77.347 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 26.248 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.272 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.795 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 10.503 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 10.578 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.262, 0.344, 0.211 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.071 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 16960, 16960 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
E.coli (Gram-negative)
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Anti-gram-negative
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Ando K, Natori S, Natori S. Molecular cloning, sequencing, and characterization of cDNA for sarcotoxin IIA, an inducible antibacterial protein of Sarcophaga peregrina (flesh fly). Biochemistry. 1988;27(5):1715-21. Published 1988 Mar 8. doi:10.1021/bi00405a050
PMID: 2452654
5.2 Protein Sequence Databases
UniProt: P14667
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: P14667
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. M18873 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR005521, IPR005520
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India