AMPDB_3740 | Cecropin

PEPTIDE SUMMARY

Cecropin

1 General Description

AMPDB ID: AMPDB_3740

Protein Names: Cecropin (Antibacterial peptide CM-IV)

Protein Family: Cecropin family

Gene Name: Nil

Source Organism: Bombyx mori (Silk moth)

Protein Length: 35 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

RWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 5, 'R': 2, 'N': 1, 'D': 1, 'C': 0, 'Q': 2, 'E': 1, 'G': 4, 'H': 0, 'I': 5, 'L': 0, 'K': 5, 'M': 0, 'F': 1, 'P': 1, 'S': 0, 'T': 1, 'W': 1, 'Y': 0, 'V': 5

Frequencies of Amino Acids

'A': 14.29%, 'R': 5.71%, 'N': 2.86%, 'D': 2.86%, 'C': 0%, 'Q': 5.71%, 'E': 2.86%, 'G': 11.43%, 'H': 0%, 'I': 14.29%, 'L': 0%, 'K': 14.29%, 'M': 0%, 'F': 2.86%, 'P': 2.86%, 'S': 0%, 'T': 2.86%, 'W': 2.86%, 'Y': 0%, 'V': 14.29%

Missing Amino Acid(s)

C, H, L, M, S, Y

Most Occurring Amino Acid(s)

A, I, K, V

Less Occurring Amino Acid(s)

D, E, F, N, P, T, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	3762.5 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	111.429	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	34.594	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.129	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.816	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.336	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	4.999	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.343, 0.171, 0.171 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.057	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5500	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Boman HG, Hultmark D, Hultmark D. Cell-free immunity in insects. Annu Rev Microbiol. 1987;41:103-26. Published 1987. doi:10.1146/annurev.mi.41.100187.000535

PMID: 3318666

5.2 Protein Sequence Databases

UniProt: P14666

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P14666

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR000875

PANTHER: Not found

PROSITE: PS00268

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download