AMPDB_3736 | Tachyplesin-2

PEPTIDE SUMMARY

Tachyplesin-2

1 General Description

AMPDB ID: AMPDB_3736

Protein Names: Tachyplesin-2 (Tachyplesin II)

Protein Family: Tachyplesin polyphemusin family

Gene Name: Nil

Source Organism: Tachypleus tridentatus (Japanese horseshoe crab)

Protein Length: 77 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKKLVIALCLMMVLAVMVEEAEARWCFRVCYRGICYRKCRGKRNEVRQYRDRGYDVRAIPDETFFTRQDEDEDDDEE

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 5, 'R': 11, 'N': 1, 'D': 8, 'C': 5, 'Q': 2, 'E': 9, 'G': 3, 'H': 0, 'I': 3, 'L': 4, 'K': 4, 'M': 4, 'F': 3, 'P': 1, 'S': 0, 'T': 2, 'W': 1, 'Y': 4, 'V': 7

Frequencies of Amino Acids

'A': 6.49%, 'R': 14.29%, 'N': 1.3%, 'D': 10.39%, 'C': 6.49%, 'Q': 2.6%, 'E': 11.69%, 'G': 3.9%, 'H': 0%, 'I': 3.9%, 'L': 5.19%, 'K': 5.19%, 'M': 5.19%, 'F': 3.9%, 'P': 1.3%, 'S': 0%, 'T': 2.6%, 'W': 1.3%, 'Y': 5.19%, 'V': 9.09%

Missing Amino Acid(s)

H, S

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

N, P, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9334.72 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	68.312	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	33.307	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.647	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.717	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.901	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-2.297	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.286, 0.065, 0.286 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.104	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	11460, 11710	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Shigenaga T, Muta T, Toh Y, et al. Antimicrobial tachyplesin peptide precursor. cDNA cloning and cellular localization in the horseshoe crab (Tachypleus tridentatus). J Biol Chem. 1990;265(34):21350-4. Published 1990 Dec 5. doi:

PMID: 2250028

Citation 2: Miyata T, Tokunaga F, Yoneya T, et al. Antimicrobial peptides, isolated from horseshoe crab hemocytes, tachyplesin II, and polyphemusins I and II: chemical structures and biological activity. J Biochem. 1989;106(4):663-8. Published 1989 Oct. doi:10.1093/oxfordjournals.jbchem.a122913

PMID: 2514185

Citation 3: Shigenaga T, Takayenoki Y, Kawasaki S, et al. Separation of large and small granules from horseshoe crab (Tachypleus tridentatus) hemocytes and characterization of their components. J Biochem. 1993;114(3):307-16. Published 1993 Sep. doi:10.1093/oxfordjournals.jbchem.a124173

PMID: 8282718

5.2 Protein Sequence Databases

UniProt: P14214

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P14214

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download