AMPDB_3733 | Phormicin

1 General Description

AMPDB ID: AMPDB_3733

Protein Names: Phormicin (Insect defensin A B)

Protein Family: Invertebrate defensin family; Type 1 subfamily

Gene Name: Nil

Source Organism: Protophormia terraenovae (Northern blowfly) (Lucilia terraenovae)

Protein Length: 94 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MKFFMVFVVTFCLAVCFVSQSLAIPADAANDAHFVDGVQALKEIEPELHGRYKRATCDLLSGTGINHSACAAHCLLRGNRGGYCNGKGVCVCRN

FASTA format

Counts of Amino Acids

'A': 11, 'R': 5, 'N': 5, 'D': 4, 'C': 8, 'Q': 2, 'E': 3, 'G': 9, 'H': 4, 'I': 3, 'L': 8, 'K': 4, 'M': 2, 'F': 6, 'P': 2, 'S': 4, 'T': 3, 'W': 0, 'Y': 2, 'V': 9

Frequencies of Amino Acids

'A': 11.7%, 'R': 5.32%, 'N': 5.32%, 'D': 4.26%, 'C': 8.51%, 'Q': 2.13%, 'E': 3.19%, 'G': 9.57%, 'H': 4.26%, 'I': 3.19%, 'L': 8.51%, 'K': 4.26%, 'M': 2.13%, 'F': 6.38%, 'P': 2.13%, 'S': 4.26%, 'T': 3.19%, 'W': 0%, 'Y': 2.13%, 'V': 9.57%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

M, P, Q, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	10109.7 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	85.106	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	29.604	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.293	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.544	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.995	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	1.87	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.298, 0.213, 0.255 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.085	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 3480	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Dimarcq JL, Zachary D, Hoffmann JA, et al. Insect immunity: expression of the two major inducible antibacterial peptides, defensin and diptericin, in Phormia terranovae. EMBO J. 1990;9(8):2507-15. Published 1990 Aug. doi:10.1002/j.1460-2075.1990.tb07430.x

PMID: 2369900

Citation 2: Lambert J, Keppi E, Dimarcq JL, et al. Insect immunity: isolation from immune blood of the dipteran Phormia terranovae of two insect antibacterial peptides with sequence homology to rabbit lung macrophage bactericidal peptides. Proc Natl Acad Sci U S A. 1989;86(1):262-6. Published 1989 Jan. doi:10.1073/pnas.86.1.262

PMID: 2911573

Citation 3: Lepage P, Bitsch F, Roecklin D, et al. Determination of disulfide bridges in natural and recombinant insect defensin A. Eur J Biochem. 1991;196(3):735-42. Published 1991 Mar 28. doi:10.1111/j.1432-1033.1991.tb15872.x

PMID: 2013293

Citation 4: Bonmatin JM, Genest M, Petit MC, et al. Progress in multidimensional NMR investigations of peptide and protein 3-D structures in solution. From structure to functional aspects. Biochimie. 1992;74(9-10):825-36. Published 1992 Sep-Oct. doi:10.1016/0300-9084(92)90065-m

PMID: 1467342

Citation 5: Cornet B, Bonmatin JM, Hetru C, et al. Refined three-dimensional solution structure of insect defensin A. Structure. 1995;3(5):435-48. Published 1995 May 15. doi:10.1016/s0969-2126(01)00177-0

PMID: 7663941

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P10891

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X55546	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

PANTHER: Not found

PROSITE: PS51378

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download