AMPDB_3731 | Conopeptide X11.1

PEPTIDE SUMMARY

Conopeptide X11.1

1 General Description

AMPDB ID: AMPDB_3731

Protein Names: Conopeptide X11.1 (I1_xm11a)

Protein Family: Conotoxin I1 superfamily

Gene Name: Nil

Source Organism: Conasprella ximenes (Interrupted cone) (Conus ximenes)

Protein Length: 76 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MMKLSVSFLLLLMLLPFITGEENSDSDVLKSGAAVRQGRGRCRGFREDCSQHRDCCGDLCCNGNTCVITVIACPKW

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 6, 'N': 3, 'D': 5, 'C': 8, 'Q': 2, 'E': 3, 'G': 7, 'H': 1, 'I': 3, 'L': 9, 'K': 3, 'M': 3, 'F': 3, 'P': 2, 'S': 6, 'T': 3, 'W': 1, 'Y': 0, 'V': 5

Frequencies of Amino Acids

'A': 3.95%, 'R': 7.89%, 'N': 3.95%, 'D': 6.58%, 'C': 10.53%, 'Q': 2.63%, 'E': 3.95%, 'G': 9.21%, 'H': 1.32%, 'I': 3.95%, 'L': 11.84%, 'K': 3.95%, 'M': 3.95%, 'F': 3.95%, 'P': 2.63%, 'S': 7.89%, 'T': 3.95%, 'W': 1.32%, 'Y': 0%, 'V': 6.58%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8370.79 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	84.605	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	24.401	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.092	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.618	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.639	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	0.6	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.276, 0.237, 0.237 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.053	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 6000	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Mycobacterium tuberculosis (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-tuberculosis, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Figueroa-Montiel A, BernÃ¡ldez J, JimÃ©nez S, et al. Antimycobacterial Activity: A New Pharmacological Target for Conotoxins Found in the First Reported Conotoxin from Conasprella ximenes. Toxins (Basel). 2018;10(2). Published 2018 Jan 23. doi:10.3390/toxins10020051

PMID: 29360782

5.2 Protein Sequence Databases

UniProt: P0DW72

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P0DW72

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR013141

PANTHER: Not found

PROSITE: PS60019

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download