AMPDB_3725 | DELTA-limacoditoxin

PEPTIDE SUMMARY

DELTA-limacoditoxin

1 General Description

AMPDB ID: AMPDB_3725

Protein Names: DELTA-limacoditoxin(2)-Dv11 (DELTA-LCTX(2)-Dv11) (Cecropin-like peptide) (Vulnericin)

Protein Family: Limacoditoxin-2 (cecropin-like) family

Gene Name: Nil

Source Organism: Doratifera vulnerans (Mottled cup moth)

Protein Length: 57 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKFAKTFLLLFVVLLLLSIVMAEPKRGFGKLLRKVFKVGRRVAGSAAEISGSSGGEE

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 5, 'R': 4, 'N': 0, 'D': 0, 'C': 0, 'Q': 0, 'E': 4, 'G': 7, 'H': 0, 'I': 2, 'L': 9, 'K': 6, 'M': 2, 'F': 5, 'P': 1, 'S': 5, 'T': 1, 'W': 0, 'Y': 0, 'V': 6

Frequencies of Amino Acids

'A': 8.77%, 'R': 7.02%, 'N': 0%, 'D': 0%, 'C': 0%, 'Q': 0%, 'E': 7.02%, 'G': 12.28%, 'H': 0%, 'I': 3.51%, 'L': 15.79%, 'K': 10.53%, 'M': 3.51%, 'F': 8.77%, 'P': 1.75%, 'S': 8.77%, 'T': 1.75%, 'W': 0%, 'Y': 0%, 'V': 10.53%

Missing Amino Acid(s)

C, D, H, N, Q, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

P, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6154.46 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	114.561	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	36.937	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.539	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.994	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.369	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	6.003	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.386, 0.228, 0.351 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.088	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 0	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

A.baumannii (Gram-negative), D.melanogaster, H.contortus, S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-candida, Anti-parasitic, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Toxin, Insecticidal, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Walker AA, Robinson SD, Paluzzi JV, et al. Production, composition, and mode of action of the painful defensive venom produced by a limacodid caterpillar, Doratifera vulnerans. Proc Natl Acad Sci U S A. 2021;118(18). Published 2021 May 4. doi:10.1073/pnas.2023815118

PMID: 33893140

5.2 Protein Sequence Databases

UniProt: P0DUS5

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P0DUS5

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download