AMPDB_370 | Cytotoxic linear peptide IsCT2

PEPTIDE SUMMARY

Cytotoxic linear peptide IsCT2

1 General Description

AMPDB ID: AMPDB_370

Protein Names: Cytotoxic linear peptide IsCT2 (Non-disulfide-bridged peptide 4.2) (NDBP-4.2) (Non-disulfide-bridged peptide 5.3) (NDBP-5.3) [Cleaved into: Cytotoxic linear peptide IsCT2f]

Protein Family: Non-disulfide-bridged peptide (NDBP) superfamily; Short antimicrobial peptide (group 4) family

Gene Name: Nil

Source Organism: Opisthacanthus madagascariensis (Scorpion)

Protein Length: 71 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKTQFAILLVALVLFQMFAQSEAIFGAIWNGIKSLFGRRALNNDLDLDGLDELFDGEISQADVDFLKELMR

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 7, 'R': 3, 'N': 3, 'D': 7, 'C': 0, 'Q': 4, 'E': 4, 'G': 5, 'H': 0, 'I': 5, 'L': 12, 'K': 3, 'M': 3, 'F': 7, 'P': 0, 'S': 3, 'T': 1, 'W': 1, 'Y': 0, 'V': 3

Frequencies of Amino Acids

'A': 9.86%, 'R': 4.23%, 'N': 4.23%, 'D': 9.86%, 'C': 0%, 'Q': 5.63%, 'E': 5.63%, 'G': 7.04%, 'H': 0%, 'I': 7.04%, 'L': 16.9%, 'K': 4.23%, 'M': 4.23%, 'F': 9.86%, 'P': 0%, 'S': 4.23%, 'T': 1.41%, 'W': 1.41%, 'Y': 0%, 'V': 4.23%

Missing Amino Acid(s)

C, H, P, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

T, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8024.3 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	115.493	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	22.92	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.344	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.569	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.092	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-4.993	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.394, 0.155, 0.366 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.113	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5500	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Toxin, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Dai L, Corzo G, Naoki H, et al. Purification, structure-function analysis, and molecular characterization of novel linear peptides from scorpion Opisthacanthus madagascariensis. Biochem Biophys Res Commun. 2002;293(5):1514-22. Published 2002 May 24. doi:10.1016/S0006-291X(02)00423-0

PMID: 12054688

Citation 2: Zeng XC, Corzo G, Hahin R, et al. Scorpion venom peptides without disulfide bridges. IUBMB Life. 2005;57(1):13-21. Published 2005 Jan. doi:10.1080/15216540500058899

PMID: 16036557

Citation 3: Almaaytah A, Albalas Q, Albalas Q. Scorpion venom peptides with no disulfide bridges: a review. Peptides. 2014;51:35-45. Published 2014 Jan. doi:10.1016/j.peptides.2013.10.021

PMID: 24184590

5.2 Protein Sequence Databases

UniProt: Q8MTX2

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q8MTX2

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AY050522	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download