AMPDB_37 | Cathelicidin-related antimicrobial peptide Bf-CRAMP

PEPTIDE SUMMARY

Cathelicidin-related antimicrobial peptide Bf-CRAMP

1 General Description

AMPDB ID: AMPDB_37

Protein Names: Cathelicidin-related antimicrobial peptide Bf-CRAMP (Cathelicidin-BF) (Vipericidin)

Protein Family: Cathelicidin family

Gene Name: Nil

Source Organism: Bungarus fasciatus (Banded krait) (Pseudoboa fasciata)

Protein Length: 191 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MEGFFWKTLLVVGALAIAGTSSLPHKPLIYEEAVDLAVSIYNSKSGEDSLYRLLEAVSPPKWDPLSESNQELNFTMKETVCLVAEERSLEECDFQEDGVVMGCTGYYFFGESPPVVVLTCKPVGEEGEQKQEEGNEEEKEVEEEEQEEDEKDQPRRVKRFKKFFRKLKKSVKKRAKEFFKKPRVIGVSIPF

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 8, 'R': 8, 'N': 4, 'D': 7, 'C': 4, 'Q': 6, 'E': 31, 'G': 12, 'H': 1, 'I': 5, 'L': 15, 'K': 20, 'M': 3, 'F': 12, 'P': 11, 'S': 13, 'T': 6, 'W': 2, 'Y': 5, 'V': 18

Frequencies of Amino Acids

'A': 4.19%, 'R': 4.19%, 'N': 2.09%, 'D': 3.66%, 'C': 2.09%, 'Q': 3.14%, 'E': 16.23%, 'G': 6.28%, 'H': 0.52%, 'I': 2.62%, 'L': 7.85%, 'K': 10.47%, 'M': 1.57%, 'F': 6.28%, 'P': 5.76%, 'S': 6.81%, 'T': 3.14%, 'W': 1.05%, 'Y': 2.62%, 'V': 9.42%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

105

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	21869.9 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	72.356	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	59.139	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.585	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.953	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.58	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-10.111	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.298, 0.209, 0.298 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.099	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	18450, 18700	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

A.nidulans (Gram-positive), A.terreus (Not characterize), Bacillus (Gram-positive), C.albicans, C.globosum, P.pastoris

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-candida, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytotoxin, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Wang Y, Hong J, Liu X, et al. Snake cathelicidin from Bungarus fasciatus is a potent peptide antibiotics. PLoS One. 2008;3(9):e3217. Published 2008 Sep 16. doi:10.1371/journal.pone.0003217

PMID: 18795096

Citation 2: Zhao H, Gan TX, Liu XD, et al. Identification and characterization of novel reptile cathelicidins from elapid snakes. Peptides. 2008;29(10):1685-91. Published 2008 Oct. doi:10.1016/j.peptides.2008.06.008

PMID: 18620012

5.2 Protein Sequence Databases

UniProt: B6D434

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: B6D434

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	EU753183	GenBank \|\| EMBL
2.	EU622893	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001894, IPR046350

PANTHER: PTHR10206

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download