AMPDB_3696 | Lantibiotic Flvbeta.e

PEPTIDE SUMMARY

Lantibiotic Flvbeta.e

1 General Description

AMPDB ID: AMPDB_3696

Protein Names: Lantibiotic Flvbeta.e

Protein Family: Nil

Gene Name: FlvA2.e

Source Organism: Ruminococcus flavefaciens

Protein Length: 72 AA

Protein Existence: Inferred from homology

2 Protein Sequence & Composition

2.1 Sequence

MNNKEFNMEQFKKLAAVVSEDELDEMLDENVTGAASSIPCAKVVVKVTTVVVAATTGFDWCPTGACTTSCRF

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 8, 'R': 1, 'N': 4, 'D': 4, 'C': 4, 'Q': 1, 'E': 6, 'G': 3, 'H': 0, 'I': 1, 'L': 3, 'K': 5, 'M': 3, 'F': 4, 'P': 2, 'S': 4, 'T': 8, 'W': 1, 'Y': 0, 'V': 10

Frequencies of Amino Acids

'A': 11.11%, 'R': 1.39%, 'N': 5.56%, 'D': 5.56%, 'C': 5.56%, 'Q': 1.39%, 'E': 8.33%, 'G': 4.17%, 'H': 0%, 'I': 1.39%, 'L': 4.17%, 'K': 6.94%, 'M': 4.17%, 'F': 5.56%, 'P': 2.78%, 'S': 5.56%, 'T': 11.11%, 'W': 1.39%, 'Y': 0%, 'V': 13.89%

Missing Amino Acid(s)

H, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

I, Q, R, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7750.86 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	73.056	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	26.624	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.119	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.471	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.233	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-4.239	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.264, 0.181, 0.278 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.069	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5750	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Lantibiotic, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Synergistic peptide, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Zhao X, van der Donk WA, van der Donk WA. Structural Characterization and Bioactivity Analysis of the Two-Component Lantibiotic Flv System from a Ruminant Bacterium. Cell Chem Biol. 2016;23(2):246-256. Published 2016 Feb 18. doi:10.1016/j.chembiol.2015.11.014

PMID: 27028884

5.2 Protein Sequence Databases

UniProt: P0DQL7

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P0DQL7

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download