AMPDB_369 | Cytotoxic linear peptide IsCT

1 General Description

AMPDB ID: AMPDB_369

Protein Names: Cytotoxic linear peptide IsCT (Non-disulfide-bridged peptide 4.1) (NDBP-4.1) (Non-disulfide-bridged peptide 5.2) (NDBP-5.2) [Cleaved into: Cytotoxic linear peptide IsCTf]

Protein Family: Non-disulfide-bridged peptide (NDBP) superfamily; Short antimicrobial peptide (group 4) family

Gene Name: Nil

Source Organism: Opisthacanthus madagascariensis (Scorpion)

Protein Length: 68 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MKTQFAILLVALVLFQMFAQSDAILGKIWEGIKSLFGKRGLSDLDGLDELFDGEISKADRDFLRELMR

FASTA format

Counts of Amino Acids

'A': 5, 'R': 4, 'N': 0, 'D': 7, 'C': 0, 'Q': 3, 'E': 4, 'G': 6, 'H': 0, 'I': 5, 'L': 12, 'K': 5, 'M': 3, 'F': 6, 'P': 0, 'S': 4, 'T': 1, 'W': 1, 'Y': 0, 'V': 2

Frequencies of Amino Acids

'A': 7.35%, 'R': 5.88%, 'N': 0%, 'D': 10.29%, 'C': 0%, 'Q': 4.41%, 'E': 5.88%, 'G': 8.82%, 'H': 0%, 'I': 7.35%, 'L': 17.65%, 'K': 7.35%, 'M': 4.41%, 'F': 8.82%, 'P': 0%, 'S': 5.88%, 'T': 1.47%, 'W': 1.47%, 'Y': 0%, 'V': 2.94%

Missing Amino Acid(s)

C, H, N, P, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

T, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7722.06 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	113.382	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	18.86	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.21	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.799	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.655	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-1.993	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.382, 0.147, 0.353 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.103	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5500	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Cytolysis, Toxin, Cytotoxin, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Dai L, Corzo G, Naoki H, et al. Purification, structure-function analysis, and molecular characterization of novel linear peptides from scorpion Opisthacanthus madagascariensis. Biochem Biophys Res Commun. 2002;293(5):1514-22. Published 2002 May 24. doi:10.1016/S0006-291X(02)00423-0

PMID: 12054688

Citation 2: Dai L, Yasuda A, Naoki H, et al. IsCT, a novel cytotoxic linear peptide from scorpion Opisthacanthus madagascariensis. Biochem Biophys Res Commun. 2001;286(4):820-5. Published 2001 Aug 31. doi:10.1006/bbrc.2001.5472

PMID: 11520071

Citation 3: Zeng XC, Corzo G, Hahin R, et al. Scorpion venom peptides without disulfide bridges. IUBMB Life. 2005;57(1):13-21. Published 2005 Jan. doi:10.1080/15216540500058899

PMID: 16036557

Citation 4: Almaaytah A, Albalas Q, Albalas Q. Scorpion venom peptides with no disulfide bridges: a review. Peptides. 2014;51:35-45. Published 2014 Jan. doi:10.1016/j.peptides.2013.10.021

PMID: 24184590

Citation 5: Lee K, Shin SY, Kim K, et al. Antibiotic activity and structural analysis of the scorpion-derived antimicrobial peptide IsCT and its analogs. Biochem Biophys Res Commun. 2004;323(2):712-9. Published 2004 Oct 15. doi:10.1016/j.bbrc.2004.08.144

PMID: 15369808

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: Q8MMJ7

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF397895	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download