AMPDB_368 | Hepcidin

PEPTIDE SUMMARY

Hepcidin

1 General Description

AMPDB ID: AMPDB_368

Protein Names: Hepcidin

Protein Family: Hepcidin family

Gene Name: HAMP

Source Organism: Sus scrofa (Pig)

Protein Length: 82 AA

Protein Existence: Inferred from homology

2 Protein Sequence & Composition

2.1 Sequence

MALSVQIRAACLLLLLLVSLTAGSVLPSQTRQLTDLRTQDTAGATAGLTPVAQRLRRDTHFPICIFCCGCCRKAICGMCCKT

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 9, 'R': 7, 'N': 0, 'D': 3, 'C': 9, 'Q': 5, 'E': 0, 'G': 5, 'H': 1, 'I': 4, 'L': 13, 'K': 2, 'M': 2, 'F': 2, 'P': 3, 'S': 4, 'T': 9, 'W': 0, 'Y': 0, 'V': 4

Frequencies of Amino Acids

'A': 10.98%, 'R': 8.54%, 'N': 0%, 'D': 3.66%, 'C': 10.98%, 'Q': 6.1%, 'E': 0%, 'G': 6.1%, 'H': 1.22%, 'I': 4.88%, 'L': 15.85%, 'K': 2.44%, 'M': 2.44%, 'F': 2.44%, 'P': 3.66%, 'S': 4.88%, 'T': 10.98%, 'W': 0%, 'Y': 0%, 'V': 4.88%

Missing Amino Acid(s)

E, N, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8770.54 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	105.976	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	40.329	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.555	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.661	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.685	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	5.532	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.28, 0.146, 0.293 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.024	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 500	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative), N.cinerea (Gram-negative), S.aureus (Gram-positive), S.epidermidis (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

No PMID found

5.2 Protein Sequence Databases

UniProt: Q8MJ80

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q8MJ80

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF516143	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_999282.1

5.5 Protein-Protein Interaction Databases

STRING: 9823.ENSSSCP00000003108

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR010500

PANTHER: PTHR16877

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: ENSGT00390000003154

KEGG: ssc:397207

5.9 Phylogenomic Databases

GeneTree: ENSGT00390000003154

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download