AMPDB_36741 | Putative cytotoxic protein
PEPTIDE SUMMARY
Putative cytotoxic protein
1 General Description
AMPDB ID: AMPDB_36741
Protein Names: Putative cytotoxic protein
Protein Family: Nil
Gene Name: BA1DRAFT_01921
Source Organism: Photorhabdus aegyptia
Protein Length: 120 AA
Protein Existence: Predicted
2 Protein Sequence & Composition
2.1 Sequence
PAHTGNEEQPFIPSQITVLPIPDKVGSDIESLPMPEEKDFRDYILVFPIPNMPPVYVYLSKPRNGLPQDGHDYHPAPKTEEITGVSGLRSAKKKTPKQSGGGKRDRWIDSKGRRIYEWDS
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 3, 'R': 7, 'N': 3, 'D': 9, 'C': 0, 'Q': 4, 'E': 8, 'G': 10, 'H': 3, 'I': 9, 'L': 6, 'K': 10, 'M': 2, 'F': 3, 'P': 16, 'S': 9, 'T': 5, 'W': 2, 'Y': 5, 'V': 6
Frequencies of Amino Acids
'A': 2.5%, 'R': 5.83%, 'N': 2.5%, 'D': 7.5%, 'C': 0%, 'Q': 3.33%, 'E': 6.67%, 'G': 8.33%, 'H': 2.5%, 'I': 7.5%, 'L': 5%, 'K': 8.33%, 'M': 1.67%, 'F': 2.5%, 'P': 13.33%, 'S': 7.5%, 'T': 4.17%, 'W': 1.67%, 'Y': 4.17%, 'V': 5%
Missing Amino Acid(s)
C
Most Occurring Amino Acid(s)
P
Less Occurring Amino Acid(s)
M, W
Hydrophobic Amino Acid(s) Count
57
Hydrophilic Amino Acid(s) Count
63
Basic Amino Acid(s) Count
17
Acidic Amino Acid(s) Count
20
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 13539.3 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 65.75 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 76.973 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.888 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.738 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 7.762 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 0.282 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.258, 0.317, 0.158 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.083 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 18450, 18450 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
E.coli (Gram-negative)
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Bacteriocin, Anti-gram-negative
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
No PMID found
5.2 Protein Sequence Databases
UniProt: A0A022PIT5
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: A0A022PIT5
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. JFGV01000023 GenBank || EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India