AMPDB_3674 | Antimicrobial peptide HsAp3

PEPTIDE SUMMARY

Antimicrobial peptide HsAp3

1 General Description

AMPDB ID: AMPDB_3674

Protein Names: Antimicrobial peptide HsAp3

Protein Family: Non-disulfide-bridged peptide (NDBP) superfamily; Medium-length antimicrobial peptide (group 3) family

Gene Name: Nil

Source Organism: Heterometrus spinifer (Asia giant forest scorpion) (Malaysian black scorpion)

Protein Length: 74 AA

Protein Existence: Inferred from homology

2 Protein Sequence & Composition

2.1 Sequence

MSRRLILTLVLVTMLVKTMAGMESKWVETTDEIKKRSGTPEKERESGRLLGVVKRYIVCVRNPCPGRRAISEQT

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 2, 'R': 9, 'N': 1, 'D': 1, 'C': 2, 'Q': 1, 'E': 7, 'G': 5, 'H': 0, 'I': 4, 'L': 7, 'K': 6, 'M': 4, 'F': 0, 'P': 3, 'S': 5, 'T': 7, 'W': 1, 'Y': 1, 'V': 8

Frequencies of Amino Acids

'A': 2.7%, 'R': 12.16%, 'N': 1.35%, 'D': 1.35%, 'C': 2.7%, 'Q': 1.35%, 'E': 9.46%, 'G': 6.76%, 'H': 0%, 'I': 5.41%, 'L': 9.46%, 'K': 8.11%, 'M': 5.41%, 'F': 0%, 'P': 4.05%, 'S': 6.76%, 'T': 9.46%, 'W': 1.35%, 'Y': 1.35%, 'V': 10.81%

Missing Amino Acid(s)

F, H

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, N, Q, W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8434.02 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	92.027	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	62.577	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.303	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.677	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.802	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	6.884	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.284, 0.189, 0.27 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.027	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	6990, 7115	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Nie Y, Zeng XC, Yang Y, et al. A novel class of antimicrobial peptides from the scorpion Heterometrus spinifer. Peptides. 2012;38(2):389-94. Published 2012 Dec. doi:10.1016/j.peptides.2012.09.012

PMID: 23000095

5.2 Protein Sequence Databases

UniProt: P0DMI9

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P0DMI9

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	JX311703	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download