AMPDB_3667 | Antimicrobial peptide 2

PEPTIDE SUMMARY

Antimicrobial peptide 2

1 General Description

AMPDB ID: AMPDB_3667

Protein Names: Antimicrobial peptide 2 (Fa-AMP2)

Protein Family: Nil

Gene Name: Nil

Source Organism: Fagopyrum esculentum (Common buckwheat) (Polygonum fagopyrum)

Protein Length: 40 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

AQCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNCR

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 4, 'R': 1, 'N': 1, 'D': 0, 'C': 8, 'Q': 4, 'E': 0, 'G': 10, 'H': 0, 'I': 0, 'L': 1, 'K': 1, 'M': 0, 'F': 0, 'P': 2, 'S': 3, 'T': 2, 'W': 2, 'Y': 1, 'V': 0

Frequencies of Amino Acids

'A': 10%, 'R': 2.5%, 'N': 2.5%, 'D': 0%, 'C': 20%, 'Q': 10%, 'E': 0%, 'G': 25%, 'H': 0%, 'I': 0%, 'L': 2.5%, 'K': 2.5%, 'M': 0%, 'F': 0%, 'P': 5%, 'S': 7.5%, 'T': 5%, 'W': 5%, 'Y': 2.5%, 'V': 0%

Missing Amino Acid(s)

D, E, F, H, I, M, V

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

K, L, N, R, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	3915.39 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	19.75	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	29.255	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.225	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.239	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.964	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	1.501	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.1, 0.4, 0.125 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.075	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	12490, 12990	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Plant defense, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Fujimura M, Minami Y, Watanabe K, et al. Purification, characterization, and sequencing of a novel type of antimicrobial peptides, Fa-AMP1 and Fa-AMP2, from seeds of buckwheat (Fagopyrum esculentum Moench.). Biosci Biotechnol Biochem. 2003;67(8):1636-42. Published 2003 Aug. doi:10.1271/bbb.67.1636

PMID: 12951494

5.2 Protein Sequence Databases

UniProt: P0DKH8

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P0DKH8

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001002, IPR018371, IPR036861

PANTHER: Not found

PROSITE: PS00026, PS50941

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download