AMPDB_3664 | Amphipathic peptide CT1

PEPTIDE SUMMARY

Amphipathic peptide CT1

1 General Description

AMPDB ID: AMPDB_3664

Protein Names: Amphipathic peptide CT1 (StCT1) (Non-disulfide-bridged peptide 4.8) (NDBP-4.8) (Non-disulfide-bridged peptide 5.16) (NDBP-5.16)

Protein Family: Non-disulfide-bridged peptide (NDBP) superfamily; Short antimicrobial peptide (group 4) family

Gene Name: Nil

Source Organism: Scorpiops tibetanus (Scorpion)

Protein Length: 74 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKTQIVILFISMIMLQMFVQIEGGFWGSLWEGVKSVVGKRGLRNLDDLDDLDLDHLFDSDVSDADLRLLKQMFR

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 1, 'R': 4, 'N': 1, 'D': 10, 'C': 0, 'Q': 4, 'E': 2, 'G': 6, 'H': 1, 'I': 5, 'L': 12, 'K': 4, 'M': 5, 'F': 5, 'P': 0, 'S': 5, 'T': 1, 'W': 2, 'Y': 0, 'V': 6

Frequencies of Amino Acids

'A': 1.35%, 'R': 5.41%, 'N': 1.35%, 'D': 13.51%, 'C': 0%, 'Q': 5.41%, 'E': 2.7%, 'G': 8.11%, 'H': 1.35%, 'I': 6.76%, 'L': 16.22%, 'K': 5.41%, 'M': 6.76%, 'F': 6.76%, 'P': 0%, 'S': 6.76%, 'T': 1.35%, 'W': 2.7%, 'Y': 0%, 'V': 8.11%

Missing Amino Acid(s)

C, P, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

A, H, N, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8561.01 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	114.459	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	36.734	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.181	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.832	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.437	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-3.904	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.405, 0.162, 0.27 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.095	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	11000, 11000	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

M.luteus (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Yuan W, Cao L, Ma Y, et al. Cloning and functional characterization of a new antimicrobial peptide gene StCT1 from the venom of the scorpion Scorpiops tibetanus. Peptides. 2010;31(1):22-6. Published 2010 Jan. doi:10.1016/j.peptides.2009.10.008

PMID: 19854232

Citation 2: Zeng XC, Zhou L, Shi W, et al. Three new antimicrobial peptides from the scorpion Pandinus imperator. Peptides. 2013;45:28-34. Published 2013 Jul. doi:10.1016/j.peptides.2013.03.026

PMID: 23624072

Citation 3: Almaaytah A, Albalas Q, Albalas Q. Scorpion venom peptides with no disulfide bridges: a review. Peptides. 2014;51:35-45. Published 2014 Jan. doi:10.1016/j.peptides.2013.10.021

PMID: 24184590

5.2 Protein Sequence Databases

UniProt: P0DJO3

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P0DJO3

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	FD664386	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download