AMPDB_3662 | Peptide Hp1090

PEPTIDE SUMMARY

Peptide Hp1090

1 General Description

AMPDB ID: AMPDB_3662

Protein Names: Peptide Hp1090 (Non-disulfide-bridged peptide 4.9) (NDBP-4.9) (Non-disulfide-bridged peptide 5.9) (NDBP-5.9)

Protein Family: Non-disulfide-bridged peptide (NDBP) superfamily; Short antimicrobial peptide (group 4) family

Gene Name: Nil

Source Organism: Heterometrus petersii (Asian forest scorpion)

Protein Length: 68 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

MKTQFAIFLITLVLFQMFSQSDAIFKAIWSGIKSLFGKRGLSDLDDLDESFDGEVSQADIDFLKELMQ

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 4, 'R': 1, 'N': 0, 'D': 8, 'C': 0, 'Q': 5, 'E': 3, 'G': 4, 'H': 0, 'I': 6, 'L': 9, 'K': 5, 'M': 3, 'F': 8, 'P': 0, 'S': 7, 'T': 2, 'W': 1, 'Y': 0, 'V': 2

Frequencies of Amino Acids

'A': 5.88%, 'R': 1.47%, 'N': 0%, 'D': 11.76%, 'C': 0%, 'Q': 7.35%, 'E': 4.41%, 'G': 5.88%, 'H': 0%, 'I': 8.82%, 'L': 13.24%, 'K': 7.35%, 'M': 4.41%, 'F': 11.76%, 'P': 0%, 'S': 10.29%, 'T': 2.94%, 'W': 1.47%, 'Y': 0%, 'V': 2.94%

Missing Amino Acid(s)

C, H, N, P, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

R, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7740.92 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	100.441	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	16.175	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.226	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.633	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.075	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-4.995	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.382, 0.162, 0.279 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.132	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5500	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Antiviral protein, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Toxin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Yan R, Zhao Z, He Y, et al. A new natural Î±-helical peptide from the venom of the scorpion Heterometrus petersii kills HCV. Peptides. 2011;32(1):11-9. Published 2011 Jan. doi:10.1016/j.peptides.2010.10.008

PMID: 20950663

Citation 2: RamÃrez-Carreto S, Quintero-HernÃ¡ndez V, JimÃ©nez-Vargas JM, et al. Gene cloning and functional characterization of four novel antimicrobial-like peptides from scorpions of the family Vaejovidae. Peptides. 2012;34(2):290-5. Published 2012 Apr. doi:10.1016/j.peptides.2012.02.002

PMID: 22342498

Citation 3: Almaaytah A, Albalas Q, Albalas Q. Scorpion venom peptides with no disulfide bridges: a review. Peptides. 2014;51:35-45. Published 2014 Jan. doi:10.1016/j.peptides.2013.10.021

PMID: 24184590

5.2 Protein Sequence Databases

UniProt: P0DJ02

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P0DJ02

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download