AMPDB_3649 | Bactridin-1
PEPTIDE SUMMARY
Bactridin-1
1 General Description
AMPDB ID: AMPDB_3649
Protein Names: Bactridin-1 (Bact1) (Bactridine 1) (P-Arthr-Antm-beta* NaTx2.6)
Protein Family: Long (4 C-C) scorpion toxin superfamily; Sodium channel inhibitor family; Beta subfamily
Gene Name: Nil
Protein Length: 61 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
KDGYIIEHRGCKYSCFFGTNSWCNTECTLKKGSSGYCAWPACWCYGLPDNVKIFDSNNLKC
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 2, 'R': 1, 'N': 5, 'D': 3, 'C': 8, 'Q': 0, 'E': 2, 'G': 6, 'H': 1, 'I': 3, 'L': 3, 'K': 6, 'M': 0, 'F': 3, 'P': 2, 'S': 5, 'T': 3, 'W': 3, 'Y': 4, 'V': 1
Frequencies of Amino Acids
'A': 3.28%, 'R': 1.64%, 'N': 8.2%, 'D': 4.92%, 'C': 13.11%, 'Q': 0%, 'E': 3.28%, 'G': 9.84%, 'H': 1.64%, 'I': 4.92%, 'L': 4.92%, 'K': 9.84%, 'M': 0%, 'F': 4.92%, 'P': 3.28%, 'S': 8.2%, 'T': 4.92%, 'W': 4.92%, 'Y': 6.56%, 'V': 1.64%
Missing Amino Acid(s)
M, Q
Most Occurring Amino Acid(s)
C
Less Occurring Amino Acid(s)
H, R, V
Hydrophobic Amino Acid(s) Count
23
Hydrophilic Amino Acid(s) Count
38
Basic Amino Acid(s) Count
5
Acidic Amino Acid(s) Count
8
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 6927.89 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 46.393 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 44.5 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.403 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.399 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 7.965 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 1.593 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.279, 0.295, 0.115 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.164 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 22460, 22960 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
A.calcoaceticus (Gram-negative), B.subtilis (Gram-positive), E.faecalis (Gram-positive), M.luteus (Gram-negative), P.aeruginosa (Gram-negative), Y.enterocolitica (Gram-negative)
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Toxin, Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Díaz P, D'Suze G, Salazar V, et al. Antibacterial activity of six novel peptides from Tityus discrepans scorpion venom. A fluorescent probe study of microbial membrane Na+ permeability changes. Toxicon. 2009;54(6):802-17. Published 2009 Nov. doi:10.1016/j.toxicon.2009.06.014
PMID: 19540868
Citation 2: Guerrero-Vargas JA, Mourão CB, Quintero-Hernández V, et al. Identification and phylogenetic analysis of Tityus pachyurus and Tityus obscurus novel putative Na+-channel scorpion toxins. PLoS One. 2012;7(2):e30478. Published 2012. doi:10.1371/journal.pone.0030478
PMID: 22355312
5.2 Protein Sequence Databases
UniProt: P0CF39
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: P0CF39
5.4 Nucleotide Sequence Databases
No entries found in GenBank or EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
PANTHER: Not found
PROSITE: PS51863
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India