AMPDB_3648 | Bactridin-2

PEPTIDE SUMMARY

Bactridin-2

1 General Description

AMPDB ID: AMPDB_3648

Protein Names: Bactridin-2 (Bact2) (Bactridine 2) (P-Mice-Antm-beta* NaTx14.8)

Protein Family: Long (4 C-C) scorpion toxin superfamily; Sodium channel inhibitor family; Beta subfamily

Gene Name: Nil

Source Organism: Tityus discrepans (Venezuelan scorpion)

Protein Length: 64 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

KDGYLVGNDGCKYSCFTRPGTYCANECSRVKGKDGYCYAWMACYCYSMPNWVKTWNRATNRCGR

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 4, 'R': 5, 'N': 5, 'D': 3, 'C': 8, 'Q': 0, 'E': 1, 'G': 7, 'H': 0, 'I': 0, 'L': 1, 'K': 5, 'M': 2, 'F': 1, 'P': 2, 'S': 3, 'T': 4, 'W': 3, 'Y': 7, 'V': 3

Frequencies of Amino Acids

'A': 6.25%, 'R': 7.81%, 'N': 7.81%, 'D': 4.69%, 'C': 12.5%, 'Q': 0%, 'E': 1.56%, 'G': 10.94%, 'H': 0%, 'I': 0%, 'L': 1.56%, 'K': 7.81%, 'M': 3.13%, 'F': 1.56%, 'P': 3.13%, 'S': 4.69%, 'T': 6.25%, 'W': 4.69%, 'Y': 10.94%, 'V': 4.69%

Missing Amino Acid(s)

H, I, Q

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

E, F, L

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7374.39 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	25.938	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	34.98	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.723	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.774	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.741	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	5.498	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.234, 0.266, 0.125 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.172	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	26930, 27430	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

A.calcoaceticus (Gram-negative), B.subtilis (Gram-positive), E.faecalis (Gram-positive), M.luteus (Gram-negative), P.aeruginosa (Gram-negative), Y.enterocolitica (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Toxin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: DÃaz P, D'Suze G, Salazar V, et al. Antibacterial activity of six novel peptides from Tityus discrepans scorpion venom. A fluorescent probe study of microbial membrane Na+ permeability changes. Toxicon. 2009;54(6):802-17. Published 2009 Nov. doi:10.1016/j.toxicon.2009.06.014

PMID: 19540868

Citation 2: Guerrero-Vargas JA, MourÃ£o CB, Quintero-HernÃ¡ndez V, et al. Identification and phylogenetic analysis of Tityus pachyurus and Tityus obscurus novel putative Na+-channel scorpion toxins. PLoS One. 2012;7(2):e30478. Published 2012. doi:10.1371/journal.pone.0030478

PMID: 22355312

5.2 Protein Sequence Databases

UniProt: P0CF37

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P0CF37

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR044062, IPR003614, IPR036574, IPR018218, IPR002061

PANTHER: Not found

PROSITE: PS51863

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download