AMPDB_3640 | Non-disulfide-bridged peptide 5.5

PEPTIDE SUMMARY

Non-disulfide-bridged peptide 5.5

1 General Description

AMPDB ID: AMPDB_3640

Protein Names: Non-disulfide-bridged peptide 5.5 (NDBP-5.5)

Protein Family: Non-disulfide-bridged peptide (NDBP) superfamily; Short antimicrobial peptide (group 4) family

Gene Name: Nil

Source Organism: Hoffmannihadrurus gertschi (Scorpion) (Hadrurus gertschi)

Protein Length: 71 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKTQFIVLIVAIVFLQLLSQSEAIFSAIAGLLSNLLGKRDLRHLDLDQFDDMFDQPEISAADMKFLQDLLR

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 6, 'R': 3, 'N': 1, 'D': 8, 'C': 0, 'Q': 6, 'E': 2, 'G': 2, 'H': 1, 'I': 6, 'L': 14, 'K': 3, 'M': 3, 'F': 6, 'P': 1, 'S': 5, 'T': 1, 'W': 0, 'Y': 0, 'V': 3

Frequencies of Amino Acids

'A': 8.45%, 'R': 4.23%, 'N': 1.41%, 'D': 11.27%, 'C': 0%, 'Q': 8.45%, 'E': 2.82%, 'G': 2.82%, 'H': 1.41%, 'I': 8.45%, 'L': 19.72%, 'K': 4.23%, 'M': 4.23%, 'F': 8.45%, 'P': 1.41%, 'S': 7.04%, 'T': 1.41%, 'W': 0%, 'Y': 0%, 'V': 4.23%

Missing Amino Acid(s)

C, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, N, P, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8081.48 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	130.563	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	48.283	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.438	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.6	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.342	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-3.905	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.408, 0.127, 0.352 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.085	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 0	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Mycobacterium abscessus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Schwartz EF, Diego-Garcia E, RodrÃguez de la Vega RC, et al. Transcriptome analysis of the venom gland of the Mexican scorpion Hadrurus gertschi (Arachnida: Scorpiones). BMC Genomics. 2007;8:119. Published 2007 May 16. doi:10.1186/1471-2164-8-119

PMID: 17506894

Citation 2: Trentini MM, das Neves RC, Santos BP, et al. Non-disulfide-Bridge Peptide 5.5 from the Scorpion Hadrurus gertschi Inhibits the Growth of Mycobacterium abscessus subsp. massiliense. Front Microbiol. 2017;8:273. Published 2017. doi:10.3389/fmicb.2017.00273

PMID: 28275372

5.2 Protein Sequence Databases

UniProt: P0C8W1

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P0C8W1

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	EL698901	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download