AMPDB_363 | Acidic phospholipase A2 BthA-1

1 General Description

AMPDB ID: AMPDB_363

Protein Names: Acidic phospholipase A2 BthA-1 (svPLA2) (EC 3.1.1.4) (BOJU-III) (BthA-I-PLA2) (Hypotensive phospholipase A2) (Phosphatidylcholine 2-acylhydrolase)

Protein Family: Phospholipase A2 family; Group II subfamily; D49 sub-subfamily

Gene Name: Nil

Source Organism: Bothrops jararacussu (Jararacussu)

Protein Length: 138 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MRTLWIMAVLLVGVEGSLWQFGKMINYVMGESGVLQYLSYGCYCGLGGQGQPTDATDRCCFVHDCCYGKVTGCDPKIDSYTYSKKNGDVVCGGDDPCKKQICECDRVATTCFRDNKDTYDIKYWFYGAKNCQEKSEPC

FASTA format

Counts of Amino Acids

'A': 4, 'R': 4, 'N': 4, 'D': 12, 'C': 14, 'Q': 6, 'E': 5, 'G': 16, 'H': 1, 'I': 5, 'L': 7, 'K': 11, 'M': 4, 'F': 4, 'P': 4, 'S': 6, 'T': 8, 'W': 3, 'Y': 10, 'V': 10

Frequencies of Amino Acids

'A': 2.9%, 'R': 2.9%, 'N': 2.9%, 'D': 8.7%, 'C': 10.14%, 'Q': 4.35%, 'E': 3.62%, 'G': 11.59%, 'H': 0.72%, 'I': 3.62%, 'L': 5.07%, 'K': 7.97%, 'M': 2.9%, 'F': 2.9%, 'P': 2.9%, 'S': 4.35%, 'T': 5.8%, 'W': 2.17%, 'Y': 7.25%, 'V': 7.25%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	15455.6 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	57.826	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	26.573	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.329	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.65	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	5.161	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-2.776	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.283, 0.217, 0.145 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.123	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	31400, 32275	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

E.coli (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

4.4 Inhibitory Effect

Blood coagulation cascade inhibiting toxin, Platelet aggregation inhibiting toxin

4.5 Other Biological Activity

Toxin, Hypotensive, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Roberto PG, Kashima S, Marcussi S, et al. Cloning and identification of a complete cDNA coding for a bactericidal and antitumoral acidic phospholipase A2 from Bothrops jararacussu venom. Protein J. 2004;23(4):273-85. Published 2004 May. doi:10.1023/b:jopc.0000027852.92208.60

PMID: 15214498

Citation 2: Roberto PG, Kashima S, Soares AM, et al. Cloning and expression of an acidic platelet aggregation inhibitor phospholipase A2 cDNA from Bothrops jararacussu venom gland. Protein Expr Purif. 2004;37(1):102-8. Published 2004 Sep. doi:10.1016/j.pep.2004.05.020

PMID: 15294287

Citation 3: AndriÃ£o-Escarso SH, Soares AM, Fontes MR, et al. Structural and functional characterization of an acidic platelet aggregation inhibitor and hypotensive phospholipase A(2) from Bothrops jararacussu snake venom. Biochem Pharmacol. 2002;64(4):723-32. Published 2002 Aug 15. doi:10.1016/s0006-2952(02)01210-8

PMID: 12167491

Citation 4: Magro AJ, Murakami MT, Marcussi S, et al. Crystal structure of an acidic platelet aggregation inhibitor and hypotensive phospholipase A2 in the monomeric and dimeric states: insights into its oligomeric state. Biochem Biophys Res Commun. 2004;323(1):24-31. Published 2004 Oct 8. doi:10.1016/j.bbrc.2004.08.046

PMID: 15351695

Citation 5: Magro AJ, Takeda AA, Soares AM, et al. Structure of BthA-I complexed with p-bromophenacyl bromide: possible correlations with lack of pharmacological activity. Acta Crystallogr D Biol Crystallogr. 2005;61(Pt 12):1670-7. Published 2005 Dec. doi:10.1107/S0907444905029598

PMID: 16301802

Citation 6: Murakami MT, Gabdoulkhakov A, Genov N, et al. Insights into metal ion binding in phospholipases A2: ultra high-resolution crystal structures of an acidic phospholipase A2 in the Ca2+ free and bound states. Biochimie. 2006;88(5):543-9. Published 2006 May. doi:10.1016/j.biochi.2005.10.014

PMID: 16376474

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: Q8AXY1

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AY145836	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

PANTHER: PTHR11716

PROSITE: PS00119, PS00118

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download