AMPDB_3622 | Venom-like beta-defensin

PEPTIDE SUMMARY

Venom-like beta-defensin

1 General Description

AMPDB ID: AMPDB_3622

Protein Names: Venom-like beta-defensin (DefB-vL) (Defensin-BvL) (OaDefB-vL) (Intermediate defensin-like peptide) (Int-DLP) (Ornithorhynchus venom defensin-like peptide) (OvDLP)

Protein Family: Nil

Gene Name: Nil

Source Organism: Ornithorhynchus anatinus (Duckbill platypus)

Protein Length: 68 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MRLLILFLAVVTLLSLAGPGSAEVRRRRRRPPCEDVNGQCQPRGNPCLRLRGACPRGSRCCMPTVAAH

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 6, 'R': 12, 'N': 2, 'D': 1, 'C': 6, 'Q': 2, 'E': 2, 'G': 6, 'H': 1, 'I': 1, 'L': 9, 'K': 0, 'M': 2, 'F': 1, 'P': 7, 'S': 3, 'T': 2, 'W': 0, 'Y': 0, 'V': 5

Frequencies of Amino Acids

'A': 8.82%, 'R': 17.65%, 'N': 2.94%, 'D': 1.47%, 'C': 8.82%, 'Q': 2.94%, 'E': 2.94%, 'G': 8.82%, 'H': 1.47%, 'I': 1.47%, 'L': 13.24%, 'K': 0%, 'M': 2.94%, 'F': 1.47%, 'P': 10.29%, 'S': 4.41%, 'T': 2.94%, 'W': 0%, 'Y': 0%, 'V': 7.35%

Missing Amino Acid(s)

K, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, F, H, I

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7454.89 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	87.5	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	78.877	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.103	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.573	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.802	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	8.721	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.235, 0.265, 0.279 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.015	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 375	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

P.aeruginosa (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Whittington CM, Papenfuss AT, Bansal P, et al. Defensins and the convergent evolution of platypus and reptile venom genes. Genome Res. 2008;18(6):986-94. Published 2008 Jun. doi:10.1101/gr.7149808

PMID: 18463304

Citation 2: Whittington CM, Papenfuss AT, Kuchel PW, et al. Expression patterns of platypus defensin and related venom genes across a range of tissue types reveal the possibility of broader functions for OvDLPs than previously suspected. Toxicon. 2008;52(4):559-65. Published 2008 Sep 15. doi:10.1016/j.toxicon.2008.07.002

PMID: 18662710

Citation 3: Torres AM, Bansal P, Koh JM, et al. Structure and antimicrobial activity of platypus 'intermediate' defensin-like peptide. FEBS Lett. 2014;588(9):1821-6. Published 2014 May 2. doi:10.1016/j.febslet.2014.03.044

PMID: 24694388

5.2 Protein Sequence Databases

UniProt: P0C8B1

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P0C8B1

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR023355

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download