AMPDB_3586 | Neocarzinostatin

1 General Description

AMPDB ID: AMPDB_3586

Protein Names: Neocarzinostatin (NCS) (Mitomalcin) (MMC)

Protein Family: Neocarzinostatin family

Gene Name: ncsA

Source Organism: Streptomyces carzinostaticus

Protein Length: 147 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MVPISIIRNRVAKVAVGSAAVLGLAVGFQTPAVAAAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYDVGQCAWVDTGVLACNPADFSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISFN

FASTA format

Counts of Amino Acids

'A': 25, 'R': 5, 'N': 5, 'D': 8, 'C': 4, 'Q': 4, 'E': 2, 'G': 18, 'H': 0, 'I': 4, 'L': 8, 'K': 2, 'M': 1, 'F': 6, 'P': 6, 'S': 13, 'T': 14, 'W': 2, 'Y': 1, 'V': 19

Frequencies of Amino Acids

'A': 17.01%, 'R': 3.4%, 'N': 3.4%, 'D': 5.44%, 'C': 2.72%, 'Q': 2.72%, 'E': 1.36%, 'G': 12.24%, 'H': 0%, 'I': 2.72%, 'L': 5.44%, 'K': 1.36%, 'M': 0.68%, 'F': 4.08%, 'P': 4.08%, 'S': 8.84%, 'T': 9.52%, 'W': 1.36%, 'Y': 0.68%, 'V': 12.93%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

M, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	14455.2 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	86.327	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	26.114	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.442	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.49	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.343	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-3.244	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.272, 0.286, 0.245 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.061	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	12490, 12740	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Cytotoxin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Sakata N, Minamitani S, Kanbe T, et al. The amino acid sequence of neocarzinostatin apoprotein deduced from the base sequence of the gene. Biol Pharm Bull. 1993;16(1):26-8. Published 1993 Jan. doi:10.1248/bpb.16.26

PMID: 8369747

Citation 2: Kuromizu K, Tsunasawa S, Maeda H, et al. Reexamination of the primary structure of an antitumor protein, neocarzinostatin. Arch Biochem Biophys. 1986;246(1):199-205. Published 1986 Apr. doi:10.1016/0003-9861(86)90464-9

PMID: 2938543

Citation 3: Gibson BW, Herlihy WC, Samy TS, et al. A revised primary structure for neocarzinostatin based on fast atom bombardment and gas chromatographic-mass spectrometry. J Biol Chem. 1984;259(17):10801-6. Published 1984 Sep 10. doi:

PMID: 6236220

Citation 4: Gao XL, Burkhart W, Burkhart W. Two- and three-dimensional proton NMR studies of apo-neocarzinostatin. Biochemistry. 1991;30(31):7730-9. Published 1991 Aug 6. doi:10.1021/bi00245a009

PMID: 1831044

Citation 5: Teplyakov A, Obmolova G, Wilson K, et al. Crystal structure of apo-neocarzinostatin at 0.15-nm resolution. Eur J Biochem. 1993;213(2):737-41. Published 1993 Apr 15. doi:10.1111/j.1432-1033.1993.tb17814.x

PMID: 8477746

Citation 6: Kim KH, Kwon BM, Myers AG, et al. Crystal structure of neocarzinostatin, an antitumor protein-chromophore complex. Science. 1993;262(5136):1042-6. Published 1993 Nov 12. doi:10.1126/science.8235619

PMID: 8235619

Citation 7: Gao X, Gao X. Three-dimensional solution structure of apo-neocarzinostatin. J Mol Biol. 1992;225(1):125-35. Published 1992 May 5. doi:10.1016/0022-2836(92)91030-s

PMID: 1533878

Citation 8: Adjadj E, Mispelter J, Quiniou E, et al. Proton NMR studies of apo-neocarzinostatin from Streptomyces carzinostaticus. Sequence-specific assignment and secondary structure. Eur J Biochem. 1990;190(2):263-71. Published 1990 Jun 20. doi:10.1111/j.1432-1033.1990.tb15571.x

PMID: 2142075

Citation 9: Adjadj E, Quiniou E, Mispelter J, et al. Three-dimensional solution structure of apo-neocarzinostatin from Streptomyces carzinostaticus determined by NMR spectroscopy. Eur J Biochem. 1992;203(3):505-11. Published 1992 Feb 1. doi:10.1111/j.1432-1033.1992.tb16576.x

PMID: 1531194

Citation 10: Remerowski ML, Glaser SJ, Sieker LC, et al. Sequential 1H NMR assignments and secondary structure of aponeocarzinostatin in solution. Biochemistry. 1990;29(36):8401-9. Published 1990 Sep 11. doi:10.1021/bi00488a029

PMID: 2147566

Citation 11: Takashima H, Amiya S, Kobayashi Y, et al. Neocarzinostatin: interaction between the antitumor-active chromophore and the carrier protein. J Biochem. 1991;109(6):807-10. Published 1991 Jun. doi:10.1093/oxfordjournals.jbchem.a123462

PMID: 1834636

Citation 12: Kuromizu K, Abe O, Maeda H, et al. Location of the disulfide bonds in the antitumor protein neocarzinostatin. Arch Biochem Biophys. 1991;286(2):569-73. Published 1991 May 1. doi:10.1016/0003-9861(91)90081-s

PMID: 1832834

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P0A3R9

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	D10996	GenBank \|\| EMBL
2.	S65575	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: DB08261, DB07776, DB08619

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR027273, IPR002186

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download