AMPDB_35856 | Cecropin-C

PEPTIDE SUMMARY

Cecropin-C

1 General Description

AMPDB ID: AMPDB_35856

Protein Names: Cecropin-C (AgCecC)

Protein Family: Cecropin family

Gene Name: CecC cec2 AGAP000692

Source Organism: Anopheles gambiae (African malaria mosquito)

Protein Length: 59 AA

Protein Existence: Inferred from homology

2 Protein Sequence & Composition

2.1 Sequence

MNFKLIFLVALVLMAAFLGQTEGRRFKKFLKKVEGAGRRVANAAQKGLPLAAGVKGLVG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 9, 'R': 4, 'N': 2, 'D': 0, 'C': 0, 'Q': 2, 'E': 2, 'G': 8, 'H': 0, 'I': 1, 'L': 9, 'K': 7, 'M': 2, 'F': 5, 'P': 1, 'S': 0, 'T': 1, 'W': 0, 'Y': 0, 'V': 6

Frequencies of Amino Acids

'A': 15.25%, 'R': 6.78%, 'N': 3.39%, 'D': 0%, 'C': 0%, 'Q': 3.39%, 'E': 3.39%, 'G': 13.56%, 'H': 0%, 'I': 1.69%, 'L': 15.25%, 'K': 11.86%, 'M': 3.39%, 'F': 8.47%, 'P': 1.69%, 'S': 0%, 'T': 1.69%, 'W': 0%, 'Y': 0%, 'V': 10.17%

Missing Amino Acid(s)

C, D, H, S, W, Y

Most Occurring Amino Acid(s)

A, L

Less Occurring Amino Acid(s)

I, P, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6301.69 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	110.847	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	19.664	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.442	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.933	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	12.175	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	8.999	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.356, 0.186, 0.373 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.085	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 0	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Zheng XL, Zheng AL, Zheng AL. Genomic organization and regulation of three cecropin genes in Anopheles gambiae. Insect Mol Biol. 2002;11(6):517-25. Published 2002 Dec. doi:10.1046/j.1365-2583.2002.00360.x

PMID: 12421409

Citation 2: Holt RA, Subramanian GM, Halpern A, et al. The genome sequence of the malaria mosquito Anopheles gambiae. Science. 2002;298(5591):129-49. Published 2002 Oct 4. doi:10.1126/science.1076181

PMID: 12364791

5.2 Protein Sequence Databases

UniProt: Q8MUF3

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q8MUF3

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF525673	GenBank \|\| EMBL
2.	AM774769	GenBank \|\| EMBL
3.	AM774770	GenBank \|\| EMBL
4.	AM774771	GenBank \|\| EMBL
5.	AM774772	GenBank \|\| EMBL
6.	AM774773	GenBank \|\| EMBL
7.	AM774774	GenBank \|\| EMBL
8.	AM774775	GenBank \|\| EMBL
9.	AM774776	GenBank \|\| EMBL
10.	AM774777	GenBank \|\| EMBL
11.	AM774778	GenBank \|\| EMBL
12.	AM774779	GenBank \|\| EMBL
13.	AM774780	GenBank \|\| EMBL
14.	AM774781	GenBank \|\| EMBL
15.	AM774782	GenBank \|\| EMBL
16.	AM774783	GenBank \|\| EMBL
17.	AM774784	GenBank \|\| EMBL
18.	AM774785	GenBank \|\| EMBL
19.	AAAB01008847	GenBank \|\| EMBL

CCDS: Not found

RefSeq: XP_311222.4

5.5 Protein-Protein Interaction Databases

STRING: 7165.AGAP000692-PA

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR000875, IPR020400

PANTHER: PTHR38329

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: aga:AgaP_AGAP000692

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download