AMPDB_3584 | Bacteriocin curvacin-A

PEPTIDE SUMMARY

Bacteriocin curvacin-A

1 General Description

AMPDB ID: AMPDB_3584

Protein Names: Bacteriocin curvacin-A

Protein Family: Bacteriocin class IIA YGNGV family

Gene Name: curA

Source Organism: Latilactobacillus curvatus (Lactobacillus curvatus)

Protein Length: 59 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MNNVKELSMTELQTITGGARSYGNGVYCNNKKCWVNRGEATQSIIGGMISGWASGLAGM

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 4, 'R': 2, 'N': 6, 'D': 0, 'C': 2, 'Q': 2, 'E': 3, 'G': 10, 'H': 0, 'I': 4, 'L': 3, 'K': 3, 'M': 4, 'F': 0, 'P': 0, 'S': 5, 'T': 4, 'W': 2, 'Y': 2, 'V': 3

Frequencies of Amino Acids

'A': 6.78%, 'R': 3.39%, 'N': 10.17%, 'D': 0%, 'C': 3.39%, 'Q': 3.39%, 'E': 5.08%, 'G': 16.95%, 'H': 0%, 'I': 6.78%, 'L': 5.08%, 'K': 5.08%, 'M': 6.78%, 'F': 0%, 'P': 0%, 'S': 8.47%, 'T': 6.78%, 'W': 3.39%, 'Y': 3.39%, 'V': 5.08%

Missing Amino Acid(s)

D, F, H, P

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, Q, R, W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6257.13 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	67.797	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	29.278	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.214	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.489	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.762	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	1.877	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.237, 0.356, 0.237 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.068	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	13980, 14105	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Carnobacterium (Gram-positive), Enterococcus faecalis (Gram-positive), Listeria monocytogenes (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-listeria, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Tichaczek PS, Vogel RF, Hammes WP, et al. Cloning and sequencing of curA encoding curvacin A, the bacteriocin produced by Lactobacillus curvatus LTH1174. Arch Microbiol. 1993;160(4):279-83. Published 1993. doi:10.1007/BF00292077

PMID: 7694558

Citation 2: Haugen HS, Fimland G, Nissen-Meyer J, et al. Three-dimensional structure in lipid micelles of the pediocin-like antimicrobial peptide curvacin A. Biochemistry. 2005;44(49):16149-57. Published 2005 Dec 13. doi:10.1021/bi051215u

PMID: 16331975

5.2 Protein Sequence Databases

UniProt: P0A311

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P0A311

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	S67323	GenBank \|\| EMBL
2.	X72223	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR002633, IPR023384, IPR023388, IPR010133

PANTHER: Not found

PROSITE: PS60030

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download