AMPDB_3582 | Colicin-E8

PEPTIDE SUMMARY

Colicin-E8

1 General Description

AMPDB ID: AMPDB_3582

Protein Names: Colicin-E8 (EC 3.1.-.-)

Protein Family: Colicin pyosin nuclease family

Gene Name: col

Source Organism: Escherichia coli

Protein Length: 205 AA

Protein Existence: Inferred from homology

2 Protein Sequence & Composition

2.1 Sequence

RFAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKSDADAALSAAQERRKQKENKEKDAKDKLDKESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKNFDDFRRKFWEEVSKDPELSKQFNPGNKKRLSQGLAPRARNKDTVGGRRSFELHHDKPISQDGGVYDMDNLRITTPKRHIDIHRGQ

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 22, 'R': 18, 'N': 9, 'D': 24, 'C': 0, 'Q': 10, 'E': 10, 'G': 16, 'H': 6, 'I': 6, 'L': 10, 'K': 29, 'M': 4, 'F': 8, 'P': 10, 'S': 9, 'T': 5, 'W': 3, 'Y': 1, 'V': 5

Frequencies of Amino Acids

'A': 10.73%, 'R': 8.78%, 'N': 4.39%, 'D': 11.71%, 'C': 0%, 'Q': 4.88%, 'E': 4.88%, 'G': 7.8%, 'H': 2.93%, 'I': 2.93%, 'L': 4.88%, 'K': 14.15%, 'M': 1.95%, 'F': 3.9%, 'P': 4.88%, 'S': 4.39%, 'T': 2.44%, 'W': 1.46%, 'Y': 0.49%, 'V': 2.44%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

121

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	23198 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	48.244	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	42.437	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-1.367	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.707	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.589	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	13.562	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.161, 0.215, 0.224 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.059	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	17990, 17990	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-gram-negative

4.3 Enzymatic Activity

Endonuclease, Hydrolase, Nuclease

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Uchimura T, Lau PC, Lau PC. Nucleotide sequences from the colicin E8 operon: homology with plasmid ColE2-P9. Mol Gen Genet. 1987;209(3):489-93. Published 1987 Oct. doi:10.1007/BF00331154

PMID: 3323826

Citation 2: Toba M, Masaki H, Ohta T, et al. Colicin E8, a DNase which indicates an evolutionary relationship between colicins E2 and E3. J Bacteriol. 1988;170(7):3237-42. Published 1988 Jul. doi:10.1128/jb.170.7.3237-3242.1988

PMID: 3290201

5.2 Protein Sequence Databases

UniProt: P09882

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P09882

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	M21404	GenBank \|\| EMBL
2.	X06119	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR037146, IPR044925, IPR003615

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download